Proteins

Explanatory text


Groups

Asco

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-
>lcl|q1_Acatu155371013 | ref | YP_001426547.1 | hypothetical protein ATCV1_Z066R [Acanthocystis turfacea Chlorella virus 1]
----MVTNTPKKNMKSSKEEEQAAELSIITGIKRLGV-DDCLERLENMCQSW---RLYET TATFESQIISMFGALDVNFDDDLIDAVSTDRGYFGLREVNDKIKKSELEAMTLFHRL-RE LNLLPTK-----NDDNETHHDSLKKITKILEMI---FYTKKVVLSSYQAKIAVHQLAAEE GVVDLNPDIDSVLGSWNLRFRMVGDDVSQFQELLLYLLDCAMENGYRKQDGFLYEPI-VI DGRNMHSYRQVYEIKEFVYSRLRKEISFEHWSKGTQNMKNISSA--VEYLT-NCHDTQLP VLHKSRGTYAFTNGVYIASE---DR------FHCF-ETSE-TPLSDSVV----------- ---------AC-KFFEMKFDNTQY-----------DDWFDIPTP-----HLDSVMNHQQW PKEVQMWLLCLIGRVLYRTNEIDSWQVCPFFVGLAGTGKSLLVLKVIKQFFETVDVGILS NNIERKFGISAFYDKMLVCAPEIRNDLAIEQAEFQSIVSGEEISVAVKFQKAFLQEWDVP IVLAGNEVPGWADAGGSIQRRLVVFEFKQPVKEGDMK---LSEKLYREMPNIIRRRT--- -----------------------------------RRTGTLRTCM--------------L TRTSGRCSRSTSSTPARQSRARRTLS-------------RASYHRSTLPWARTAWC---- -------LSRTSRAHSRTTPLPTLCT

Irido

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-
>lcl|q1_Acatu155371013 | ref | YP_001426547.1 | hypothetical protein ATCV1_Z066R [Acanthocystis turfacea Chlorella virus 1]
----MVTNTPKKNMKSSKEEEQAAELSIITGIKRLGV-DDCLERLENMCQSW---RLYET TATFESQIISMFGALDVNFDDDLIDAVSTDRGYFGLREVNDKIKKSELEAMTLFHRL-RE LNLLPTK-----NDDNETHHDSLKKITKILEMI---FYTKKVVLSSYQAKIAVHQLAAEE GVVDLNPDIDSVLGSWNLRFRMVGDDVSQFQELLLYLLDCAMENGYRKQDGFLYEPI-VI DGRNMHSYRQVYEIKEFVYSRLRKEISFEHWSKGTQNMKNISSA--VEYLT-NCHDTQLP VLHKSRGTYAFTNGVYIASE---DR------FHCF-ETSE-TPLSDSVV----------- ---------AC-KFFEMKFDNTQY-----------DDWFDIPTP-----HLDSVMNHQQW PKEVQMWLLCLIGRVLYRTNEIDSWQVCPFFVGLAGTGKSLLVLKVIKQFFETVDVGILS NNIERKFGISAFYDKMLVCAPEIRNDLAIEQAEFQSIVSGEEISVAVKFQKAFLQEWDVP IVLAGNEVPGWADAGGSIQRRLVVFEFKQPVKEGDMK---LSEKLYREMPNIIRRRT--- -----------------------------------RRTGTLRTCM--------------L TRTSGRCSRSTSSTPARQSRARRTLS-------------RASYHRSTLPWARTAWC---- -------LSRTSRAHSRTTPLPTLCT

Mimi

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-
>lcl|q1_Acatu155371013 | ref | YP_001426547.1 | hypothetical protein ATCV1_Z066R [Acanthocystis turfacea Chlorella virus 1]
----MVTNTPKKNMKSSKEEEQAAELSIITGIKRLGV-DDCLERLENMCQSW---RLYET TATFESQIISMFGALDVNFDDDLIDAVSTDRGYFGLREVNDKIKKSELEAMTLFHRL-RE LNLLPTK-----NDDNETHHDSLKKITKILEMI---FYTKKVVLSSYQAKIAVHQLAAEE GVVDLNPDIDSVLGSWNLRFRMVGDDVSQFQELLLYLLDCAMENGYRKQDGFLYEPI-VI DGRNMHSYRQVYEIKEFVYSRLRKEISFEHWSKGTQNMKNISSA--VEYLT-NCHDTQLP VLHKSRGTYAFTNGVYIASE---DR------FHCF-ETSE-TPLSDSVV----------- ---------AC-KFFEMKFDNTQY-----------DDWFDIPTP-----HLDSVMNHQQW PKEVQMWLLCLIGRVLYRTNEIDSWQVCPFFVGLAGTGKSLLVLKVIKQFFETVDVGILS NNIERKFGISAFYDKMLVCAPEIRNDLAIEQAEFQSIVSGEEISVAVKFQKAFLQEWDVP IVLAGNEVPGWADAGGSIQRRLVVFEFKQPVKEGDMK---LSEKLYREMPNIIRRRT--- -----------------------------------RRTGTLRTCM--------------L TRTSGRCSRSTSSTPARQSRARRTLS-------------RASYHRSTLPWARTAWC---- -------LSRTSRAHSRTTPLPTLCT

Phycodna

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-
>lcl|q1_Acatu155371013 | ref | YP_001426547.1 | hypothetical protein ATCV1_Z066R [Acanthocystis turfacea Chlorella virus 1]
----MVTNTPKKNMKSSKEEEQAAELSIITGIKRLGV-DDCLERLENMCQSW---RLYET TATFESQIISMFGALDVNFDDDLIDAVSTDRGYFGLREVNDKIKKSELEAMTLFHRL-RE LNLLPTK-----NDDNETHHDSLKKITKILEMI---FYTKKVVLSSYQAKIAVHQLAAEE GVVDLNPDIDSVLGSWNLRFRMVGDDVSQFQELLLYLLDCAMENGYRKQDGFLYEPI-VI DGRNMHSYRQVYEIKEFVYSRLRKEISFEHWSKGTQNMKNISSA--VEYLT-NCHDTQLP VLHKSRGTYAFTNGVYIASE---DR------FHCF-ETSE-TPLSDSVV----------- ---------AC-KFFEMKFDNTQY-----------DDWFDIPTP-----HLDSVMNHQQW PKEVQMWLLCLIGRVLYRTNEIDSWQVCPFFVGLAGTGKSLLVLKVIKQFFETVDVGILS NNIERKFGISAFYDKMLVCAPEIRNDLAIEQAEFQSIVSGEEISVAVKFQKAFLQEWDVP IVLAGNEVPGWADAGGSIQRRLVVFEFKQPVKEGDMK---LSEKLYREMPNIIRRRT--- -----------------------------------RRTGTLRTCM--------------L TRTSGRCSRSTSSTPARQSRARRTLS-------------RASYHRSTLPWARTAWC---- -------LSRTSRAHSRTTPLPTLCT

Masilia

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-
>lcl|q1_Acatu155371013 | ref | YP_001426547.1 | hypothetical protein ATCV1_Z066R [Acanthocystis turfacea Chlorella virus 1]
----MVTNTPKKNMKSSKEEEQAAELSIITGIKRLGV-DDCLERLENMCQSW---RLYET TATFESQIISMFGALDVNFDDDLIDAVSTDRGYFGLREVNDKIKKSELEAMTLFHRL-RE LNLLPTK-----NDDNETHHDSLKKITKILEMI---FYTKKVVLSSYQAKIAVHQLAAEE GVVDLNPDIDSVLGSWNLRFRMVGDDVSQFQELLLYLLDCAMENGYRKQDGFLYEPI-VI DGRNMHSYRQVYEIKEFVYSRLRKEISFEHWSKGTQNMKNISSA--VEYLT-NCHDTQLP VLHKSRGTYAFTNGVYIASE---DR------FHCF-ETSE-TPLSDSVV----------- ---------AC-KFFEMKFDNTQY-----------DDWFDIPTP-----HLDSVMNHQQW PKEVQMWLLCLIGRVLYRTNEIDSWQVCPFFVGLAGTGKSLLVLKVIKQFFETVDVGILS NNIERKFGISAFYDKMLVCAPEIRNDLAIEQAEFQSIVSGEEISVAVKFQKAFLQEWDVP IVLAGNEVPGWADAGGSIQRRLVVFEFKQPVKEGDMK---LSEKLYREMPNIIRRRT--- -----------------------------------RRTGTLRTCM--------------L TRTSGRCSRSTSSTPARQSRARRTLS-------------RASYHRSTLPWARTAWC---- -------LSRTSRAHSRTTPLPTLCT

Asfa

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-
>lcl|q1_Acatu155371013 | ref | YP_001426547.1 | hypothetical protein ATCV1_Z066R [Acanthocystis turfacea Chlorella virus 1]
----MVTNTPKKNMKSSKEEEQAAELSIITGIKRLGV-DDCLERLENMCQSW---RLYET TATFESQIISMFGALDVNFDDDLIDAVSTDRGYFGLREVNDKIKKSELEAMTLFHRL-RE LNLLPTK-----NDDNETHHDSLKKITKILEMI---FYTKKVVLSSYQAKIAVHQLAAEE GVVDLNPDIDSVLGSWNLRFRMVGDDVSQFQELLLYLLDCAMENGYRKQDGFLYEPI-VI DGRNMHSYRQVYEIKEFVYSRLRKEISFEHWSKGTQNMKNISSA--VEYLT-NCHDTQLP VLHKSRGTYAFTNGVYIASE---DR------FHCF-ETSE-TPLSDSVV----------- ---------AC-KFFEMKFDNTQY-----------DDWFDIPTP-----HLDSVMNHQQW PKEVQMWLLCLIGRVLYRTNEIDSWQVCPFFVGLAGTGKSLLVLKVIKQFFETVDVGILS NNIERKFGISAFYDKMLVCAPEIRNDLAIEQAEFQSIVSGEEISVAVKFQKAFLQEWDVP IVLAGNEVPGWADAGGSIQRRLVVFEFKQPVKEGDMK---LSEKLYREMPNIIRRRT--- -----------------------------------RRTGTLRTCM--------------L TRTSGRCSRSTSSTPARQSRARRTLS-------------RASYHRSTLPWARTAWC---- -------LSRTSRAHSRTTPLPTLCT

Pox

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-
>lcl|q1_Acatu155371013 | ref | YP_001426547.1 | hypothetical protein ATCV1_Z066R [Acanthocystis turfacea Chlorella virus 1]
----MVTNTPKKNMKSSKEEEQAAELSIITGIKRLGV-DDCLERLENMCQSW---RLYET TATFESQIISMFGALDVNFDDDLIDAVSTDRGYFGLREVNDKIKKSELEAMTLFHRL-RE LNLLPTK-----NDDNETHHDSLKKITKILEMI---FYTKKVVLSSYQAKIAVHQLAAEE GVVDLNPDIDSVLGSWNLRFRMVGDDVSQFQELLLYLLDCAMENGYRKQDGFLYEPI-VI DGRNMHSYRQVYEIKEFVYSRLRKEISFEHWSKGTQNMKNISSA--VEYLT-NCHDTQLP VLHKSRGTYAFTNGVYIASE---DR------FHCF-ETSE-TPLSDSVV----------- ---------AC-KFFEMKFDNTQY-----------DDWFDIPTP-----HLDSVMNHQQW PKEVQMWLLCLIGRVLYRTNEIDSWQVCPFFVGLAGTGKSLLVLKVIKQFFETVDVGILS NNIERKFGISAFYDKMLVCAPEIRNDLAIEQAEFQSIVSGEEISVAVKFQKAFLQEWDVP IVLAGNEVPGWADAGGSIQRRLVVFEFKQPVKEGDMK---LSEKLYREMPNIIRRRT--- -----------------------------------RRTGTLRTCM--------------L TRTSGRCSRSTSSTPARQSRARRTLS-------------RASYHRSTLPWARTAWC---- -------LSRTSRAHSRTTPLPTLCT

Proteins for Row 2 (LowCompl singletons)

Row 2: 16 Asco

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-
>lcl|q1_Acatu155371013 | ref | YP_001426547.1 | hypothetical protein ATCV1_Z066R [Acanthocystis turfacea Chlorella virus 1]
----MVTNTPKKNMKSSKEEEQAAELSIITGIKRLGV-DDCLERLENMCQSW---RLYET TATFESQIISMFGALDVNFDDDLIDAVSTDRGYFGLREVNDKIKKSELEAMTLFHRL-RE LNLLPTK-----NDDNETHHDSLKKITKILEMI---FYTKKVVLSSYQAKIAVHQLAAEE GVVDLNPDIDSVLGSWNLRFRMVGDDVSQFQELLLYLLDCAMENGYRKQDGFLYEPI-VI DGRNMHSYRQVYEIKEFVYSRLRKEISFEHWSKGTQNMKNISSA--VEYLT-NCHDTQLP VLHKSRGTYAFTNGVYIASE---DR------FHCF-ETSE-TPLSDSVV----------- ---------AC-KFFEMKFDNTQY-----------DDWFDIPTP-----HLDSVMNHQQW PKEVQMWLLCLIGRVLYRTNEIDSWQVCPFFVGLAGTGKSLLVLKVIKQFFETVDVGILS NNIERKFGISAFYDKMLVCAPEIRNDLAIEQAEFQSIVSGEEISVAVKFQKAFLQEWDVP IVLAGNEVPGWADAGGSIQRRLVVFEFKQPVKEGDMK---LSEKLYREMPNIIRRRT--- -----------------------------------RRTGTLRTCM--------------L TRTSGRCSRSTSSTPARQSRARRTLS-------------RASYHRSTLPWARTAWC---- -------LSRTSRAHSRTTPLPTLCT

Row 2: 23 Irido

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-
>lcl|q1_Acatu155371013 | ref | YP_001426547.1 | hypothetical protein ATCV1_Z066R [Acanthocystis turfacea Chlorella virus 1]
----MVTNTPKKNMKSSKEEEQAAELSIITGIKRLGV-DDCLERLENMCQSW---RLYET TATFESQIISMFGALDVNFDDDLIDAVSTDRGYFGLREVNDKIKKSELEAMTLFHRL-RE LNLLPTK-----NDDNETHHDSLKKITKILEMI---FYTKKVVLSSYQAKIAVHQLAAEE GVVDLNPDIDSVLGSWNLRFRMVGDDVSQFQELLLYLLDCAMENGYRKQDGFLYEPI-VI DGRNMHSYRQVYEIKEFVYSRLRKEISFEHWSKGTQNMKNISSA--VEYLT-NCHDTQLP VLHKSRGTYAFTNGVYIASE---DR------FHCF-ETSE-TPLSDSVV----------- ---------AC-KFFEMKFDNTQY-----------DDWFDIPTP-----HLDSVMNHQQW PKEVQMWLLCLIGRVLYRTNEIDSWQVCPFFVGLAGTGKSLLVLKVIKQFFETVDVGILS NNIERKFGISAFYDKMLVCAPEIRNDLAIEQAEFQSIVSGEEISVAVKFQKAFLQEWDVP IVLAGNEVPGWADAGGSIQRRLVVFEFKQPVKEGDMK---LSEKLYREMPNIIRRRT--- -----------------------------------RRTGTLRTCM--------------L TRTSGRCSRSTSSTPARQSRARRTLS-------------RASYHRSTLPWARTAWC---- -------LSRTSRAHSRTTPLPTLCT

Row 2: 8 Mimi

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-
>lcl|q1_Acatu155371013 | ref | YP_001426547.1 | hypothetical protein ATCV1_Z066R [Acanthocystis turfacea Chlorella virus 1]
----MVTNTPKKNMKSSKEEEQAAELSIITGIKRLGV-DDCLERLENMCQSW---RLYET TATFESQIISMFGALDVNFDDDLIDAVSTDRGYFGLREVNDKIKKSELEAMTLFHRL-RE LNLLPTK-----NDDNETHHDSLKKITKILEMI---FYTKKVVLSSYQAKIAVHQLAAEE GVVDLNPDIDSVLGSWNLRFRMVGDDVSQFQELLLYLLDCAMENGYRKQDGFLYEPI-VI DGRNMHSYRQVYEIKEFVYSRLRKEISFEHWSKGTQNMKNISSA--VEYLT-NCHDTQLP VLHKSRGTYAFTNGVYIASE---DR------FHCF-ETSE-TPLSDSVV----------- ---------AC-KFFEMKFDNTQY-----------DDWFDIPTP-----HLDSVMNHQQW PKEVQMWLLCLIGRVLYRTNEIDSWQVCPFFVGLAGTGKSLLVLKVIKQFFETVDVGILS NNIERKFGISAFYDKMLVCAPEIRNDLAIEQAEFQSIVSGEEISVAVKFQKAFLQEWDVP IVLAGNEVPGWADAGGSIQRRLVVFEFKQPVKEGDMK---LSEKLYREMPNIIRRRT--- -----------------------------------RRTGTLRTCM--------------L TRTSGRCSRSTSSTPARQSRARRTLS-------------RASYHRSTLPWARTAWC---- -------LSRTSRAHSRTTPLPTLCT

Row 2: 45 Phycodna

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-
>lcl|q1_Acatu155371013 | ref | YP_001426547.1 | hypothetical protein ATCV1_Z066R [Acanthocystis turfacea Chlorella virus 1]
----MVTNTPKKNMKSSKEEEQAAELSIITGIKRLGV-DDCLERLENMCQSW---RLYET TATFESQIISMFGALDVNFDDDLIDAVSTDRGYFGLREVNDKIKKSELEAMTLFHRL-RE LNLLPTK-----NDDNETHHDSLKKITKILEMI---FYTKKVVLSSYQAKIAVHQLAAEE GVVDLNPDIDSVLGSWNLRFRMVGDDVSQFQELLLYLLDCAMENGYRKQDGFLYEPI-VI DGRNMHSYRQVYEIKEFVYSRLRKEISFEHWSKGTQNMKNISSA--VEYLT-NCHDTQLP VLHKSRGTYAFTNGVYIASE---DR------FHCF-ETSE-TPLSDSVV----------- ---------AC-KFFEMKFDNTQY-----------DDWFDIPTP-----HLDSVMNHQQW PKEVQMWLLCLIGRVLYRTNEIDSWQVCPFFVGLAGTGKSLLVLKVIKQFFETVDVGILS NNIERKFGISAFYDKMLVCAPEIRNDLAIEQAEFQSIVSGEEISVAVKFQKAFLQEWDVP IVLAGNEVPGWADAGGSIQRRLVVFEFKQPVKEGDMK---LSEKLYREMPNIIRRRT--- -----------------------------------RRTGTLRTCM--------------L TRTSGRCSRSTSSTPARQSRARRTLS-------------RASYHRSTLPWARTAWC---- -------LSRTSRAHSRTTPLPTLCT

Row 2: 7 Masilia

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-

Row 2: 5 Asfa

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-

Row 2: 45 Pox

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-
>lcl|q1_Acatu155371013 | ref | YP_001426547.1 | hypothetical protein ATCV1_Z066R [Acanthocystis turfacea Chlorella virus 1]
----MVTNTPKKNMKSSKEEEQAAELSIITGIKRLGV-DDCLERLENMCQSW---RLYET TATFESQIISMFGALDVNFDDDLIDAVSTDRGYFGLREVNDKIKKSELEAMTLFHRL-RE LNLLPTK-----NDDNETHHDSLKKITKILEMI---FYTKKVVLSSYQAKIAVHQLAAEE GVVDLNPDIDSVLGSWNLRFRMVGDDVSQFQELLLYLLDCAMENGYRKQDGFLYEPI-VI DGRNMHSYRQVYEIKEFVYSRLRKEISFEHWSKGTQNMKNISSA--VEYLT-NCHDTQLP VLHKSRGTYAFTNGVYIASE---DR------FHCF-ETSE-TPLSDSVV----------- ---------AC-KFFEMKFDNTQY-----------DDWFDIPTP-----HLDSVMNHQQW PKEVQMWLLCLIGRVLYRTNEIDSWQVCPFFVGLAGTGKSLLVLKVIKQFFETVDVGILS NNIERKFGISAFYDKMLVCAPEIRNDLAIEQAEFQSIVSGEEISVAVKFQKAFLQEWDVP IVLAGNEVPGWADAGGSIQRRLVVFEFKQPVKEGDMK---LSEKLYREMPNIIRRRT--- -----------------------------------RRTGTLRTCM--------------L TRTSGRCSRSTSSTPARQSRARRTLS-------------RASYHRSTLPWARTAWC---- -------LSRTSRAHSRTTPLPTLCT

Proteins for Row 3

Row 3: 3 Asco

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-
>lcl|q1_Acatu155371013 | ref | YP_001426547.1 | hypothetical protein ATCV1_Z066R [Acanthocystis turfacea Chlorella virus 1]
----MVTNTPKKNMKSSKEEEQAAELSIITGIKRLGV-DDCLERLENMCQSW---RLYET TATFESQIISMFGALDVNFDDDLIDAVSTDRGYFGLREVNDKIKKSELEAMTLFHRL-RE LNLLPTK-----NDDNETHHDSLKKITKILEMI---FYTKKVVLSSYQAKIAVHQLAAEE GVVDLNPDIDSVLGSWNLRFRMVGDDVSQFQELLLYLLDCAMENGYRKQDGFLYEPI-VI DGRNMHSYRQVYEIKEFVYSRLRKEISFEHWSKGTQNMKNISSA--VEYLT-NCHDTQLP VLHKSRGTYAFTNGVYIASE---DR------FHCF-ETSE-TPLSDSVV----------- ---------AC-KFFEMKFDNTQY-----------DDWFDIPTP-----HLDSVMNHQQW PKEVQMWLLCLIGRVLYRTNEIDSWQVCPFFVGLAGTGKSLLVLKVIKQFFETVDVGILS NNIERKFGISAFYDKMLVCAPEIRNDLAIEQAEFQSIVSGEEISVAVKFQKAFLQEWDVP IVLAGNEVPGWADAGGSIQRRLVVFEFKQPVKEGDMK---LSEKLYREMPNIIRRRT--- -----------------------------------RRTGTLRTCM--------------L TRTSGRCSRSTSSTPARQSRARRTLS-------------RASYHRSTLPWARTAWC---- -------LSRTSRAHSRTTPLPTLCT

Row 3: 8 Irido

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-
>lcl|q1_Acatu155371013 | ref | YP_001426547.1 | hypothetical protein ATCV1_Z066R [Acanthocystis turfacea Chlorella virus 1]
----MVTNTPKKNMKSSKEEEQAAELSIITGIKRLGV-DDCLERLENMCQSW---RLYET TATFESQIISMFGALDVNFDDDLIDAVSTDRGYFGLREVNDKIKKSELEAMTLFHRL-RE LNLLPTK-----NDDNETHHDSLKKITKILEMI---FYTKKVVLSSYQAKIAVHQLAAEE GVVDLNPDIDSVLGSWNLRFRMVGDDVSQFQELLLYLLDCAMENGYRKQDGFLYEPI-VI DGRNMHSYRQVYEIKEFVYSRLRKEISFEHWSKGTQNMKNISSA--VEYLT-NCHDTQLP VLHKSRGTYAFTNGVYIASE---DR------FHCF-ETSE-TPLSDSVV----------- ---------AC-KFFEMKFDNTQY-----------DDWFDIPTP-----HLDSVMNHQQW PKEVQMWLLCLIGRVLYRTNEIDSWQVCPFFVGLAGTGKSLLVLKVIKQFFETVDVGILS NNIERKFGISAFYDKMLVCAPEIRNDLAIEQAEFQSIVSGEEISVAVKFQKAFLQEWDVP IVLAGNEVPGWADAGGSIQRRLVVFEFKQPVKEGDMK---LSEKLYREMPNIIRRRT--- -----------------------------------RRTGTLRTCM--------------L TRTSGRCSRSTSSTPARQSRARRTLS-------------RASYHRSTLPWARTAWC---- -------LSRTSRAHSRTTPLPTLCT

Row 3: 2 Mimi

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-
>lcl|q1_Acatu155371013 | ref | YP_001426547.1 | hypothetical protein ATCV1_Z066R [Acanthocystis turfacea Chlorella virus 1]
----MVTNTPKKNMKSSKEEEQAAELSIITGIKRLGV-DDCLERLENMCQSW---RLYET TATFESQIISMFGALDVNFDDDLIDAVSTDRGYFGLREVNDKIKKSELEAMTLFHRL-RE LNLLPTK-----NDDNETHHDSLKKITKILEMI---FYTKKVVLSSYQAKIAVHQLAAEE GVVDLNPDIDSVLGSWNLRFRMVGDDVSQFQELLLYLLDCAMENGYRKQDGFLYEPI-VI DGRNMHSYRQVYEIKEFVYSRLRKEISFEHWSKGTQNMKNISSA--VEYLT-NCHDTQLP VLHKSRGTYAFTNGVYIASE---DR------FHCF-ETSE-TPLSDSVV----------- ---------AC-KFFEMKFDNTQY-----------DDWFDIPTP-----HLDSVMNHQQW PKEVQMWLLCLIGRVLYRTNEIDSWQVCPFFVGLAGTGKSLLVLKVIKQFFETVDVGILS NNIERKFGISAFYDKMLVCAPEIRNDLAIEQAEFQSIVSGEEISVAVKFQKAFLQEWDVP IVLAGNEVPGWADAGGSIQRRLVVFEFKQPVKEGDMK---LSEKLYREMPNIIRRRT--- -----------------------------------RRTGTLRTCM--------------L TRTSGRCSRSTSSTPARQSRARRTLS-------------RASYHRSTLPWARTAWC---- -------LSRTSRAHSRTTPLPTLCT

Row 3: 10 Phycodna

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-
>lcl|q1_Acatu155371013 | ref | YP_001426547.1 | hypothetical protein ATCV1_Z066R [Acanthocystis turfacea Chlorella virus 1]
----MVTNTPKKNMKSSKEEEQAAELSIITGIKRLGV-DDCLERLENMCQSW---RLYET TATFESQIISMFGALDVNFDDDLIDAVSTDRGYFGLREVNDKIKKSELEAMTLFHRL-RE LNLLPTK-----NDDNETHHDSLKKITKILEMI---FYTKKVVLSSYQAKIAVHQLAAEE GVVDLNPDIDSVLGSWNLRFRMVGDDVSQFQELLLYLLDCAMENGYRKQDGFLYEPI-VI DGRNMHSYRQVYEIKEFVYSRLRKEISFEHWSKGTQNMKNISSA--VEYLT-NCHDTQLP VLHKSRGTYAFTNGVYIASE---DR------FHCF-ETSE-TPLSDSVV----------- ---------AC-KFFEMKFDNTQY-----------DDWFDIPTP-----HLDSVMNHQQW PKEVQMWLLCLIGRVLYRTNEIDSWQVCPFFVGLAGTGKSLLVLKVIKQFFETVDVGILS NNIERKFGISAFYDKMLVCAPEIRNDLAIEQAEFQSIVSGEEISVAVKFQKAFLQEWDVP IVLAGNEVPGWADAGGSIQRRLVVFEFKQPVKEGDMK---LSEKLYREMPNIIRRRT--- -----------------------------------RRTGTLRTCM--------------L TRTSGRCSRSTSSTPARQSRARRTLS-------------RASYHRSTLPWARTAWC---- -------LSRTSRAHSRTTPLPTLCT

Row 3: 1 Masilia

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-

Row 3: 1 Asfa

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-

Row 3: 20 Pox

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-
>lcl|q1_Acatu155371013 | ref | YP_001426547.1 | hypothetical protein ATCV1_Z066R [Acanthocystis turfacea Chlorella virus 1]
----MVTNTPKKNMKSSKEEEQAAELSIITGIKRLGV-DDCLERLENMCQSW---RLYET TATFESQIISMFGALDVNFDDDLIDAVSTDRGYFGLREVNDKIKKSELEAMTLFHRL-RE LNLLPTK-----NDDNETHHDSLKKITKILEMI---FYTKKVVLSSYQAKIAVHQLAAEE GVVDLNPDIDSVLGSWNLRFRMVGDDVSQFQELLLYLLDCAMENGYRKQDGFLYEPI-VI DGRNMHSYRQVYEIKEFVYSRLRKEISFEHWSKGTQNMKNISSA--VEYLT-NCHDTQLP VLHKSRGTYAFTNGVYIASE---DR------FHCF-ETSE-TPLSDSVV----------- ---------AC-KFFEMKFDNTQY-----------DDWFDIPTP-----HLDSVMNHQQW PKEVQMWLLCLIGRVLYRTNEIDSWQVCPFFVGLAGTGKSLLVLKVIKQFFETVDVGILS NNIERKFGISAFYDKMLVCAPEIRNDLAIEQAEFQSIVSGEEISVAVKFQKAFLQEWDVP IVLAGNEVPGWADAGGSIQRRLVVFEFKQPVKEGDMK---LSEKLYREMPNIIRRRT--- -----------------------------------RRTGTLRTCM--------------L TRTSGRCSRSTSSTPARQSRARRTLS-------------RASYHRSTLPWARTAWC---- -------LSRTSRAHSRTTPLPTLCT

Proteins for Row 4

Row 4: 3 Asco

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-
>lcl|q1_Acatu155371013 | ref | YP_001426547.1 | hypothetical protein ATCV1_Z066R [Acanthocystis turfacea Chlorella virus 1]
----MVTNTPKKNMKSSKEEEQAAELSIITGIKRLGV-DDCLERLENMCQSW---RLYET TATFESQIISMFGALDVNFDDDLIDAVSTDRGYFGLREVNDKIKKSELEAMTLFHRL-RE LNLLPTK-----NDDNETHHDSLKKITKILEMI---FYTKKVVLSSYQAKIAVHQLAAEE GVVDLNPDIDSVLGSWNLRFRMVGDDVSQFQELLLYLLDCAMENGYRKQDGFLYEPI-VI DGRNMHSYRQVYEIKEFVYSRLRKEISFEHWSKGTQNMKNISSA--VEYLT-NCHDTQLP VLHKSRGTYAFTNGVYIASE---DR------FHCF-ETSE-TPLSDSVV----------- ---------AC-KFFEMKFDNTQY-----------DDWFDIPTP-----HLDSVMNHQQW PKEVQMWLLCLIGRVLYRTNEIDSWQVCPFFVGLAGTGKSLLVLKVIKQFFETVDVGILS NNIERKFGISAFYDKMLVCAPEIRNDLAIEQAEFQSIVSGEEISVAVKFQKAFLQEWDVP IVLAGNEVPGWADAGGSIQRRLVVFEFKQPVKEGDMK---LSEKLYREMPNIIRRRT--- -----------------------------------RRTGTLRTCM--------------L TRTSGRCSRSTSSTPARQSRARRTLS-------------RASYHRSTLPWARTAWC---- -------LSRTSRAHSRTTPLPTLCT

Row 4: 8 Irido

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-
>lcl|q1_Acatu155371013 | ref | YP_001426547.1 | hypothetical protein ATCV1_Z066R [Acanthocystis turfacea Chlorella virus 1]
----MVTNTPKKNMKSSKEEEQAAELSIITGIKRLGV-DDCLERLENMCQSW---RLYET TATFESQIISMFGALDVNFDDDLIDAVSTDRGYFGLREVNDKIKKSELEAMTLFHRL-RE LNLLPTK-----NDDNETHHDSLKKITKILEMI---FYTKKVVLSSYQAKIAVHQLAAEE GVVDLNPDIDSVLGSWNLRFRMVGDDVSQFQELLLYLLDCAMENGYRKQDGFLYEPI-VI DGRNMHSYRQVYEIKEFVYSRLRKEISFEHWSKGTQNMKNISSA--VEYLT-NCHDTQLP VLHKSRGTYAFTNGVYIASE---DR------FHCF-ETSE-TPLSDSVV----------- ---------AC-KFFEMKFDNTQY-----------DDWFDIPTP-----HLDSVMNHQQW PKEVQMWLLCLIGRVLYRTNEIDSWQVCPFFVGLAGTGKSLLVLKVIKQFFETVDVGILS NNIERKFGISAFYDKMLVCAPEIRNDLAIEQAEFQSIVSGEEISVAVKFQKAFLQEWDVP IVLAGNEVPGWADAGGSIQRRLVVFEFKQPVKEGDMK---LSEKLYREMPNIIRRRT--- -----------------------------------RRTGTLRTCM--------------L TRTSGRCSRSTSSTPARQSRARRTLS-------------RASYHRSTLPWARTAWC---- -------LSRTSRAHSRTTPLPTLCT

Row 4: 3 Mimi

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-
>lcl|q1_Acatu155371013 | ref | YP_001426547.1 | hypothetical protein ATCV1_Z066R [Acanthocystis turfacea Chlorella virus 1]
----MVTNTPKKNMKSSKEEEQAAELSIITGIKRLGV-DDCLERLENMCQSW---RLYET TATFESQIISMFGALDVNFDDDLIDAVSTDRGYFGLREVNDKIKKSELEAMTLFHRL-RE LNLLPTK-----NDDNETHHDSLKKITKILEMI---FYTKKVVLSSYQAKIAVHQLAAEE GVVDLNPDIDSVLGSWNLRFRMVGDDVSQFQELLLYLLDCAMENGYRKQDGFLYEPI-VI DGRNMHSYRQVYEIKEFVYSRLRKEISFEHWSKGTQNMKNISSA--VEYLT-NCHDTQLP VLHKSRGTYAFTNGVYIASE---DR------FHCF-ETSE-TPLSDSVV----------- ---------AC-KFFEMKFDNTQY-----------DDWFDIPTP-----HLDSVMNHQQW PKEVQMWLLCLIGRVLYRTNEIDSWQVCPFFVGLAGTGKSLLVLKVIKQFFETVDVGILS NNIERKFGISAFYDKMLVCAPEIRNDLAIEQAEFQSIVSGEEISVAVKFQKAFLQEWDVP IVLAGNEVPGWADAGGSIQRRLVVFEFKQPVKEGDMK---LSEKLYREMPNIIRRRT--- -----------------------------------RRTGTLRTCM--------------L TRTSGRCSRSTSSTPARQSRARRTLS-------------RASYHRSTLPWARTAWC---- -------LSRTSRAHSRTTPLPTLCT

Row 4: 11 Phycodna

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-
>lcl|q1_Acatu155371013 | ref | YP_001426547.1 | hypothetical protein ATCV1_Z066R [Acanthocystis turfacea Chlorella virus 1]
----MVTNTPKKNMKSSKEEEQAAELSIITGIKRLGV-DDCLERLENMCQSW---RLYET TATFESQIISMFGALDVNFDDDLIDAVSTDRGYFGLREVNDKIKKSELEAMTLFHRL-RE LNLLPTK-----NDDNETHHDSLKKITKILEMI---FYTKKVVLSSYQAKIAVHQLAAEE GVVDLNPDIDSVLGSWNLRFRMVGDDVSQFQELLLYLLDCAMENGYRKQDGFLYEPI-VI DGRNMHSYRQVYEIKEFVYSRLRKEISFEHWSKGTQNMKNISSA--VEYLT-NCHDTQLP VLHKSRGTYAFTNGVYIASE---DR------FHCF-ETSE-TPLSDSVV----------- ---------AC-KFFEMKFDNTQY-----------DDWFDIPTP-----HLDSVMNHQQW PKEVQMWLLCLIGRVLYRTNEIDSWQVCPFFVGLAGTGKSLLVLKVIKQFFETVDVGILS NNIERKFGISAFYDKMLVCAPEIRNDLAIEQAEFQSIVSGEEISVAVKFQKAFLQEWDVP IVLAGNEVPGWADAGGSIQRRLVVFEFKQPVKEGDMK---LSEKLYREMPNIIRRRT--- -----------------------------------RRTGTLRTCM--------------L TRTSGRCSRSTSSTPARQSRARRTLS-------------RASYHRSTLPWARTAWC---- -------LSRTSRAHSRTTPLPTLCT

Row 4: 1 Masilia

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-

Row 4: 1 Asfa

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-

Row 4: 20 Pox

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-
>lcl|q1_Acatu155371013 | ref | YP_001426547.1 | hypothetical protein ATCV1_Z066R [Acanthocystis turfacea Chlorella virus 1]
----MVTNTPKKNMKSSKEEEQAAELSIITGIKRLGV-DDCLERLENMCQSW---RLYET TATFESQIISMFGALDVNFDDDLIDAVSTDRGYFGLREVNDKIKKSELEAMTLFHRL-RE LNLLPTK-----NDDNETHHDSLKKITKILEMI---FYTKKVVLSSYQAKIAVHQLAAEE GVVDLNPDIDSVLGSWNLRFRMVGDDVSQFQELLLYLLDCAMENGYRKQDGFLYEPI-VI DGRNMHSYRQVYEIKEFVYSRLRKEISFEHWSKGTQNMKNISSA--VEYLT-NCHDTQLP VLHKSRGTYAFTNGVYIASE---DR------FHCF-ETSE-TPLSDSVV----------- ---------AC-KFFEMKFDNTQY-----------DDWFDIPTP-----HLDSVMNHQQW PKEVQMWLLCLIGRVLYRTNEIDSWQVCPFFVGLAGTGKSLLVLKVIKQFFETVDVGILS NNIERKFGISAFYDKMLVCAPEIRNDLAIEQAEFQSIVSGEEISVAVKFQKAFLQEWDVP IVLAGNEVPGWADAGGSIQRRLVVFEFKQPVKEGDMK---LSEKLYREMPNIIRRRT--- -----------------------------------RRTGTLRTCM--------------L TRTSGRCSRSTSSTPARQSRARRTLS-------------RASYHRSTLPWARTAWC---- -------LSRTSRAHSRTTPLPTLCT