Clusters

Explanatory text

LowCompl_singletons

>lcl|u1_Lumsk15150522 | ref | NP_150517.1 | LSDV083 putative NTPase [Lumpy skin disease virus NI-2490]
MASHLVNNEYIFVLKKIGVHTSHRESEDPRFVDIFTCEELENYILKNPSCTLFETLRDEEAYSVVRVFFDVDLDIVLDEI DYTAALEDFILNVTKFVSIFSSRECGTNQNIVLKCMRSNFSLTKSTDTSRTSFHIVFPDTYTNMDTLIYMKKPLLEFLRS SENPLIRSIDPAVYRRKATLRIVGTRKNPNNDKIHIRQPPHNNISDYLFTYVNMNEKSCYFTLSKKVDDKKADVLWEPNY IHFNDAMKKVSKIIINEIVNINDFNVNNFTSIPIIIDYIMPCALCKKKIHKHHHQLTLGNGILKIFKAGNPHSCKVKAIA LEGNKLFTISQLIIDSNVIHLTERGDHVVWIKNSWKFNTDEPLITKLILNMKDQLPSEYIPDILCPRKRKVIENNLKDML VDTIETDTYPFMLPFKNGVLDICSGKFYKGAESKKFICTVSTGFNLDIEQYLNEDSQEMKDLNNIINDIQPLTEENKENR ELYERTLSSCLCGSTKQCLTFFFGETATGKSTTKKLLQSSIGELFIETGQTILTDIIDKGPNPFISNMHLKRSVFCSELP DFSCSGSKKIKADNIKKLTEPCIVGRPCFSNRIHNKNHASIIIDTNYKPVFDKVDNALMRRIALVKFRTHFSQYSNSDSV KNNAAYDDVKPLDENLDMKIQKNYFRYAFLNLLVKWYQKYHIPTMRLFPTPEAIPDFVFQLRVGSLLIPSSSTHLKFMSS LSKIGYVLENDLMVLPLQLFQQKISKHFNIKVYGNDIESFITKHKKFANVSEEYLEYIFIEDIISK
>lcl|l2_Invir15078896 | ref | NP_149647.1 | 184R [Invertebrate iridescent virus 6]
MTDVFKVLTPAKNINGEHTHVSMGDTKGTWYLSLNKSQEFYNVYGLALKNGQKLSLAEKPGEYVPLLVDIDLKKEVNGYP NYGSNDFYNDEDIINVVKIFQNAVSENVNRHAKKLTNKNLRCVVLEKDIFIERINESEDKYIVKKGIHLHFPHLFLPKKD IKNSFMPVVKTMIDQENVFQDFINSMDNQIMPSSLIDDISSKYWLMYGSSKEGLNKPYKISKILDHNQQEISISKCFKSE TCIDGSPITDTNVEFELPMLLSINPKPSIISNKLFYFKEAPVKLCDALLPVVNNNREKEGRMSSREIEKMKKLTSFLSVS RADDYNQWWTVGITLFNIGTGRDCEEEALEAWKMFSSQSTKYDESRCDLEWAEMKKKNRPLNARTMGSLIFMAKSDNPVA LEKYLLAEQMNIENWTSHQNLDVESIKKLKVPVFDTEIAEMFVSQHEDEYLNGNLGWFKFNGTIWSSLESVGRHMRPSLV SLSRSYLNLIPALKYITKTLQNDDEGYEPSDSGFGFDDDDSASTSGGKTTAEITKLVNSKIKLINDLAKKCQNNGPQMSL MKVIEDMIGIDNLNDKMDQNKQLIAFTNGVYDLSLFTFRQGLPEDYITRQMTIPYDITLTMENPKVIKMLNFFKKIFPDE ELFEYFMLENCEMYIGGNRDKILQIWTGEGDNGKSVTNKIIENKFGKLSVKFPKGMVTGDPPKAGACFPELTRAQRGVRW AVVDEFAPDETVNAGVIKNLTGGIDNLYARDIQQKGKDVIDIDPFFKLIFICNTIPNIRNPDNATWNRIRVIPFESTFKD SIDDISLEEQKRDKIFLKDTSFCEKETIRELGEAFAWYLIQVFIKKEQARRDARLNGKSFKIKIPAKVNEATELYKAQGN AIADYFNDKFEISDDDNDTINIKLYYQDFLLWFSQT HSNKNVNIDKKKFMKLFVQHAKGDMNTFICTKLKLKETLEEFNL ENNEENGMPLF

Helicase_primase

>lcl|u1_Lumsk15150522 | ref | NP_150517.1 | LSDV083 putative NTPase [Lumpy skin disease virus NI-2490]
MASHLVNNEYIFVLKKIGVHTSHRESEDPRFVDIFTCEELENYILKNPSCTLFETLRDEEAYSVVRVFFDVDLDIVLDEI DYTAALEDFILNVTKFVSIFSSRECGTNQNIVLKCMRSNFSLTKSTDTSRTSFHIVFPDTYTNMDTLIYMKKPLLEFLRS SENPLIRSIDPAVYRRKATLRIVGTRKNPNNDKIHIRQPPHNNISDYLFTYVNMNEKSCYFTLSKKVDDKKADVLWEPNY IHFNDAMKKVSKIIINEIVNINDFNVNNFTSIPIIIDYIMPCALCKKKIHKHHHQLTLGNGILKIFKAGNPHSCKVKAIA LEGNKLFTISQLIIDSNVIHLTERGDHVVWIKNSWKFNTDEPLITKLILNMKDQLPSEYIPDILCPRKRKVIENNLKDML VDTIETDTYPFMLPFKNGVLDICSGKFYKGAESKKFICTVSTGFNLDIEQYLNEDSQEMKDLNNIINDIQPLTEENKENR ELYERTLSSCLCGSTKQCLTFFFGETATGKSTTKKLLQSSIGELFIETGQTILTDIIDKGPNPFISNMHLKRSVFCSELP DFSCSGSKKIKADNIKKLTEPCIVGRPCFSNRIHNKNHASIIIDTNYKPVFDKVDNALMRRIALVKFRTHFSQYSNSDSV KNNAAYDDVKPLDENLDMKIQKNYFRYAFLNLLVKWYQKYHIPTMRLFPTPEAIPDFVFQLRVGSLLIPSSSTHLKFMSS LSKIGYVLENDLMVLPLQLFQQKISKHFNIKVYGNDIESFITKHKKFANVSEEYLEYIFIEDIISK
>lcl|l2_Invir15078896 | ref | NP_149647.1 | 184R [Invertebrate iridescent virus 6]
MTDVFKVLTPAKNINGEHTHVSMGDTKGTWYLSLNKSQEFYNVYGLALKNGQKLSLAEKPGEYVPLLVDIDLKKEVNGYP NYGSNDFYNDEDIINVVKIFQNAVSENVNRHAKKLTNKNLRCVVLEKDIFIERINESEDKYIVKKGIHLHFPHLFLPKKD IKNSFMPVVKTMIDQENVFQDFINSMDNQIMPSSLIDDISSKYWLMYGSSKEGLNKPYKISKILDHNQQEISISKCFKSE TCIDGSPITDTNVEFELPMLLSINPKPSIISNKLFYFKEAPVKLCDALLPVVNNNREKEGRMSSREIEKMKKLTSFLSVS RADDYNQWWTVGITLFNIGTGRDCEEEALEAWKMFSSQSTKYDESRCDLEWAEMKKKNRPLNARTMGSLIFMAKSDNPVA LEKYLLAEQMNIENWTSHQNLDVESIKKLKVPVFDTEIAEMFVSQHEDEYLNGNLGWFKFNGTIWSSLESVGRHMRPSLV SLSRSYLNLIPALKYITKTLQNDDEGYEPSDSGFGFDDDDSASTSGGKTTAEITKLVNSKIKLINDLAKKCQNNGPQMSL MKVIEDMIGIDNLNDKMDQNKQLIAFTNGVYDLSLFTFRQGLPEDYITRQMTIPYDITLTMENPKVIKMLNFFKKIFPDE ELFEYFMLENCEMYIGGNRDKILQIWTGEGDNGKSVTNKIIENKFGKLSVKFPKGMVTGDPPKAGACFPELTRAQRGVRW AVVDEFAPDETVNAGVIKNLTGGIDNLYARDIQQKGKDVIDIDPFFKLIFICNTIPNIRNPDNATWNRIRVIPFESTFKD SIDDISLEEQKRDKIFLKDTSFCEKETIRELGEAFAWYLIQVFIKKEQARRDARLNGKSFKIKIPAKVNEATELYKAQGN AIADYFNDKFEISDDDNDTINIKLYYQDFLLWFSQT HSNKNVNIDKKKFMKLFVQHAKGDMNTFICTKLKLKETLEEFNL ENNEENGMPLF

D5_helicase_primase

>lcl|u1_Lumsk15150522 | ref | NP_150517.1 | LSDV083 putative NTPase [Lumpy skin disease virus NI-2490]
MASHLVNNEYIFVLKKIGVHTSHRESEDPRFVDIFTCEELENYILKNPSCTLFETLRDEEAYSVVRVFFDVDLDIVLDEI DYTAALEDFILNVTKFVSIFSSRECGTNQNIVLKCMRSNFSLTKSTDTSRTSFHIVFPDTYTNMDTLIYMKKPLLEFLRS SENPLIRSIDPAVYRRKATLRIVGTRKNPNNDKIHIRQPPHNNISDYLFTYVNMNEKSCYFTLSKKVDDKKADVLWEPNY IHFNDAMKKVSKIIINEIVNINDFNVNNFTSIPIIIDYIMPCALCKKKIHKHHHQLTLGNGILKIFKAGNPHSCKVKAIA LEGNKLFTISQLIIDSNVIHLTERGDHVVWIKNSWKFNTDEPLITKLILNMKDQLPSEYIPDILCPRKRKVIENNLKDML VDTIETDTYPFMLPFKNGVLDICSGKFYKGAESKKFICTVSTGFNLDIEQYLNEDSQEMKDLNNIINDIQPLTEENKENR ELYERTLSSCLCGSTKQCLTFFFGETATGKSTTKKLLQSSIGELFIETGQTILTDIIDKGPNPFISNMHLKRSVFCSELP DFSCSGSKKIKADNIKKLTEPCIVGRPCFSNRIHNKNHASIIIDTNYKPVFDKVDNALMRRIALVKFRTHFSQYSNSDSV KNNAAYDDVKPLDENLDMKIQKNYFRYAFLNLLVKWYQKYHIPTMRLFPTPEAIPDFVFQLRVGSLLIPSSSTHLKFMSS LSKIGYVLENDLMVLPLQLFQQKISKHFNIKVYGNDIESFITKHKKFANVSEEYLEYIFIEDIISK
>lcl|l2_Invir15078896 | ref | NP_149647.1 | 184R [Invertebrate iridescent virus 6]
MTDVFKVLTPAKNINGEHTHVSMGDTKGTWYLSLNKSQEFYNVYGLALKNGQKLSLAEKPGEYVPLLVDIDLKKEVNGYP NYGSNDFYNDEDIINVVKIFQNAVSENVNRHAKKLTNKNLRCVVLEKDIFIERINESEDKYIVKKGIHLHFPHLFLPKKD IKNSFMPVVKTMIDQENVFQDFINSMDNQIMPSSLIDDISSKYWLMYGSSKEGLNKPYKISKILDHNQQEISISKCFKSE TCIDGSPITDTNVEFELPMLLSINPKPSIISNKLFYFKEAPVKLCDALLPVVNNNREKEGRMSSREIEKMKKLTSFLSVS RADDYNQWWTVGITLFNIGTGRDCEEEALEAWKMFSSQSTKYDESRCDLEWAEMKKKNRPLNARTMGSLIFMAKSDNPVA LEKYLLAEQMNIENWTSHQNLDVESIKKLKVPVFDTEIAEMFVSQHEDEYLNGNLGWFKFNGTIWSSLESVGRHMRPSLV SLSRSYLNLIPALKYITKTLQNDDEGYEPSDSGFGFDDDDSASTSGGKTTAEITKLVNSKIKLINDLAKKCQNNGPQMSL MKVIEDMIGIDNLNDKMDQNKQLIAFTNGVYDLSLFTFRQGLPEDYITRQMTIPYDITLTMENPKVIKMLNFFKKIFPDE ELFEYFMLENCEMYIGGNRDKILQIWTGEGDNGKSVTNKIIENKFGKLSVKFPKGMVTGDPPKAGACFPELTRAQRGVRW AVVDEFAPDETVNAGVIKNLTGGIDNLYARDIQQKGKDVIDIDPFFKLIFICNTIPNIRNPDNATWNRIRVIPFESTFKD SIDDISLEEQKRDKIFLKDTSFCEKETIRELGEAFAWYLIQVFIKKEQARRDARLNGKSFKIKIPAKVNEATELYKAQGN AIADYFNDKFEISDDDNDTINIKLYYQDFLLWFSQT HSNKNVNIDKKKFMKLFVQHAKGDMNTFICTKLKLKETLEEFNL ENNEENGMPLF
>lcl|u1_Tanvi157939706 | ref | YP_001497078.1 | NTPase [Tanapox virus]
MAGSISNNEHVFVLKSIGVPSSHRQSEDPRFVDIFTCEELESYIEKNPTCTLFETLRDEEAYSVVRVFFDVDLDAVLDEI DYIAALEDFILEITNFVSKFSVMECGANQNTVLKCMRSNFSLTKSSNKNKTSFHMIFPDTYTTINTLIAMKKPLLEFLRS SENPLIRSIDPAVYRRKATLRIVGTRKISNNDSIHLKQPPHDNISDYLFTYVKFHNNSCYFSLSKRLEDVLPSSLWEPNY IPFNEAIKKVSKIIMNDIINLKDLDINNFTTIPLVIDYVMPCALCKKKSHKHHHQLSLGNGMIKIYKAGNPHSCKVKAIM LEGNKLFTISQLIMDANVIRLTERGDHIVWIKNSWKFNNEEPVITKLVLNMKDQLPSEYTPDILCPRKRKVIENNLKDML VDTVETDTYPHILPFKNGVLDITSGKFYHGEESKKFICTASTDFNFEMDKFLNDTSIEMKELECIIDDIQPKTCENLKNR ELYERTLSSCLCGSTKQCITFFFGETATGKSTTKRLLQSAIGDLFIETGQTILTDLMDKGPNPFISNMHLKRSVFCSELP DFACSGSKKIRADNVKKLTEPCIVGRSCFSNKINNRNHASIIIDTNYKPIFDRVDCALMRRVSLVKFRTHFSQPSSAEAA KSNSAYDDVKPLDENLDMKIQKKYYRFAFLNMLVKWYQKYHVPTMRLFPTPDAVPDFAFQLKVSSIIVASSSTHLSLISK LSKIGYVIENDLIVLPSNIFQQKLAGHFNIKIHGHDIESFINRHKKFANVSEEYLEYIFIEDITSK
>lcl|q1_ParMT155122350 | gb | ABT14218.1 | hypothetical protein MT325_M664L [Paramecium bursaria chlorella virus MT325]
MSEAYIISWCKKRGYYGRTGDLSHVLLDKGVLCVPDSSHEEFLSEYARGVVKGGKFSCVVEYKPKVFRMFYDLDIVATKT LAETMTSSTFSEEIDEILKEICGTTADLFDIGKTEVTLCISNVSKKVADGVKVGIHLTFNNIFVTSTVALHVRSKVLEKL EERNNPFVNKWEDIVDAAVHKGSGMRLPWASKPTEPNRVYVPKLSYTLERGADVREEQLTEIHHSFAATRSLLLNVSLRT RGTLTKLVDSIADDSFESPSMAGSIQHSSLAEYSEIIKEVEKAIPKEYEGRVTGVLKTEFVYMFRHSSKYCANVERQHHS SNTYFLVSRSGLRQCCYSRKVDFEEKSCPCAKFRGDLIELPRKVMTELFPETPPQTPRIVAKPMPADQAEFSINKMEDYV TKVLKPTAKKSNPKPKPKTAKKSSVYAMFMP
>lcl|u2_Melsa9631496 | ref | NP_048160.1 | ORF MSV089 Putative NTPase, Rabbit fibroma virus C5 (vaccinia D5R) homolog, similar to PIR:G41700 [Melanoplus sanguinipes entomopoxvirus]
MDKYIYLQKGLKVKLLDKKKCILEEEYVNQIDKLTLDELLEKINNAIENNDSIEEYHEIILNEYHDRFKLFFDIELKKKY NSDYFDSTFENFKDEISSFLASVFIEFYNINSTLELNEDDLKNHIFDGISATTSNDPNKISTHVFFTNILVSNSVFTTLK IHIHNYKKRTTNELILGIDEQVFKNNTLLRCIYSKKSNSKYYHTEYDDQIESVNDLQKYLVTFVDDDEDNILIDTIDTDE CELTVEDGIFPHLKVFNGHVFLEKFRQTLFKASITIDSNTKTLIKNLETIELNQTLDIYLQTQHACICGKITHKNHHYLF FNQNNIQLIKYGNRHNCRIIKFEYPKLDSTAITKFIKDLDIVRKVNKDLKLYWDGMKWMPIIDDMIYGKIALKLLDEYKN TMLLHDKKYVSTKYFKEAKVRILTDLSDSTDTYNTNPYLIQMCNGIFDLKNNIFIYGIEAKKYIKPNYIPLSYKNIEEMS EEEYNNYMENYNMLVTVINNIIPENHKDRKIFECNISSSLLQISKETITFLVGPTKSGKTTIKLLLAALFGNLFLTIPII DYVKQHNPHSPNAWLGKLNGKLVCFASESNACDKFDSQTIKHMTERIIISRVLNSNEGDQHNYATQIIDTNIFPSIDITD NAILERLAVINIDHSYFINSTKIDSVNENILKDRNNILDTRVIRPRNPNFSNKIENGDFSLALFNILKEWVRKYHLDELK IIHTPEKFIKTTNTNKKMDTPNEDNQNNKMLTLVSSINFNNTNKNIKMHNIKCNYNRYYSTIKKLTRSRKAIEIIVINEK FIKEFEHLIPNEYKKVILNQPYVALEHLIEPKEI
>lcl|l5_Frovi49237319 | ref | YP_031600.1 | putative D5 family NTPase/ATPase [Frog virus 3]
MANATIKYTTMDLYGILKSCKCSSDERLTHQSLSGGRFSVTGSKVGEFWRAVADRIESGEPIDISEARQKETPLTLDFDV VDKDCKEPVPDVLVNNIHAAVARWARSSLKPAPEDRDLCGVVLTKPVRQCAKGWKKGFHIQYPKLVLETGVAKNLVVGPA LRPICSKVWEAVTGTAKDYLDPLSCTVPWLVYGASKPDEPFAWKIARTLDHAGKTIDFNTAFGDVETPPSWGRPTSDRHR EAMVLSIHPAGRSVFFRRYDFTAANPGRVTRLADYSAVMAKLDVARQRKPAWNTDATKAHRLKRVTDLTAMLTADLADDR QTWLNVGFCLWQQTSGSAEGYKVWLSFSKKSDKCDEDECWTIWNNQMRPNSFTEGTLVYLAQKHNPGAYLNWLQVKSTPV NDIGTNVAMAKIMWDYYGHQFVCCGGKTQTWYRFDGLTWVESNQGTDLRSLISAEGGPLRRLLMRQLDAVTAAKARGGRD SGNEDDEEDSATDEDDSNPWDSELRRLDSEVLDTMVKRLRNNLKGIEMTGVKNNVLRECAELFYQPEFGDVIDSDPLLFA FANGIYDFREGCLRDGRPEDKLSRRAPVDFVMFGPIPKARHPDNSPVMRPKRMPGESVQDHARRLAECFEQDDVSASAGT MGKEDVESFSCNPNDFKGPVTKLLAFFASVFPDEGTRRFFLRNAAATFVGGNPDKVVLFWTGTGNNGKTVTQTLFEKMLG CFAVKMSTQTLTGRKPSAGSANPEMARLGGGVRWAVMEEPNSDETINAGTLKSMTGNDSFFARDLYCAGKTTFEIKPMFK LHVICNALPGIKDADQATWNRVRVVPFESTFVTPGTTAPADAKYVFPADTDITRKLDRLTAPLAWYLVYCWACIQNERVK YVPPPKVMEATMAYQKEHDLFRQFVEEMLRKDPDST LTCDDAYTAFRDWTSANSPHGTVRRPKGQVVKCLEAILGKKTVD GWPGYAVGAEQQE
>lcl|b1_Helvi134287274 | ref | YP_001110970.1 | ATPase [Heliothis virescens ascovirus 3e]
MSLKKSLKASTCDNTTNVVALPRPNGEVCIQSGKYSLDHVQQYTFLSHYALATVDGIANIAEIPTERSPLRFDFDIKAPV TATPVPVKPLHTARELAGVVGVVCNAVRQNVSTEDNGVCFTILTLEKPPRISDQHVKHGFHLHCPDLWCDRSTAAAITET VAGILKDKLFVCGVPISGCVDPCGGKPWLMYGSSKDDTSRSYKLSGAYFCDNTGAPEPVSPLQVLSRIRDPVATERFRDL FMTPEAEMSATWQTRDCEITWITTWTYYLSVRMSIINSKRFYRPSTIPAVVTPVAATVNGPAGVPPSAVCNEPLNSEEAE QFSRHIKSCVRLLSEQRSAERNTWMRVFWALKDTVQKGYMKGDEAFECFQNFSMLWKQCDPDEIRSMWLRDSANTPSGRR VTYASIFYDAKSDNADAYRILAESHRKELARIRRKAKAAVKATTRSAEPTTVSRKTSIARKRQTDIITADNSGVVAKASA VRRRYRTDDDYDESESDEYDDDDEYDDYLHNRLNSSNSQRLPGIGGGDGDLPPGVQISDNELTQMDDTDFDIASMFVRDW GRCVTMVGKVMYQFNGNIWKPVRNDEALIRKELPIWYDKFEEHVSEYLERLAESGMGAVPHGDEDSNGGRGPSVVTVAKR KFLSVRRKCKNSAPQSGVITQIRALNTHDAGAYKSTKMDDNDNIIAFKDMVFCRDTLTLRKGTPEDMISRCLNCNYVPYD ELTDEVRKFVNDFFTSLFPDPEVKEYFLLSVAQIFRGSNIFKQYMVWTGVGNNGKSVLIRMFECLLGPLLVKLSKSVLIS NKMDVGSVNPDMCKLQGVRLAVTDEIAGSDDINVGQAKLLSGNDTFMARDLYMKSAEMEPIKAQFIPIIVCNDLPSLREP DEAAWKRFHIIPFDSYFTTELDGFLPHGVDRKHVQ LSRTDIDSTVIADKHLEGFASLLLKIYIDNERASRNRISGSDVSQ GLRMPERVRELLKHHKMKQNPIFELLECKFTYDIENNDLLSYEKLCTMVNDRRRTRGACMDDVKKWTLEVINWREYRHNS SGLIGFVPMNNA
>lcl|u1_Orfvi41057131 | ref | NP_957845.1 | ORF068 NTPase [Orf virus]
MAAPICDNSHVFLLKRLGVPSSCRRSEDPRFVEILTPFELSNYIERHPGCCLFETLRDEEDCSVVRVFADVDMDSVLEEE DFVAALEDLIVELAAFFDRFASGSCGTVPGEVKRAMLANFSVTRSTAEHKTSFHLIFTETYTTLDTLVAAKRPLLDLCRR SDNVLLRALDTAVYRHGATLRVVGTRKTPESSAVHRMQSPDDDIKDYLFTFVELSDASVYFELAEREQHTLSTVCWETSY IPFGDAMRRVCQAVVNDIVNLRDITEDNFLDTPLVIDYATRCALCKKPKHKHAHHITMGNGCLRLVKGGNAHSCKVKIIQ LEGNRLFTAAQIIIASEVVKLTERNDYIVWLNNSWRFSAEESLITKLILDVRHSLPADYANDMLCPRKRKVVETNIRDML VDISETDTQYDKLPFTNGVLDLATGEFLTGDRAKACVCTVSTGYAFSREEFAAAADSEAMRRLVGVINDIQPDTPENAEN RALYERAMSSALCGATKTVIVFFYGDTMTGKSTSKRLLMSALGGLFIETGQTVLTDVLDKGPNPFVANMHLRRAVFCSEL PDFACNNARKLRSDNFKKLTEPCIVGRPCFSNKIHNRNHATFIIDTNYRPVFDRVDNALMRRVALVRFRTHFSSAATRAA AAHNVEYSAVKEMDESLDTKIQRNYFRYAFLRLLVQWFGKYHVPQVSLAPTPDAVPDFAFHCRVAELVVASNDTHRRAME SLSKLGYVLVGGNVAMPADAFRQRLAAHFNVRVHGGDIDAFMFKHKKVVNVTEEYVEYVFIEDVENK
>lcl|u1_Goavi148912960 | ref | YP_001293274.1 | hypothetical protein GTPV_gp079 [Goatpox virus Pellor]
MASHLVNNEYIFVLKKIGVHTSHRESEDPRFVDIFTCEELENYILKNPSCTLFETLRDEEAYSVVRVFFDVDLDIVLDEI DYTAALEDFILNVTKFVSIFSSRECSTNQNIVLKCMRSNFSLTKSTDTSRTSFHIVFPDTYTNMDTLIYMKKPLLEFLRS SENPLIRSIDPAVYRKKATLRIVGTRKNPNNDKIHIKQPPHNNISDYLFTYVNINEKSCYFTLSKKVDDKKTDVLWEPNY IHFNDAMKKVSKLIINEIVNINDFNVNNFTSIPIIIDYIMPCALCKKKIHKHHHQLTLGNGILKIFKAGNPHSCKVKAIA LEGNKLFTISQLIMDSNVIHLTERGDHVVWIKNSWKFNTDEPLITKLILNMKDQLPSEYIPDILCPRKRKVIENNLKDML VDTIETDTYPFMLPFKNGVLDICSGKFYKGAESKKFICTVSTGFNLDIEKYLNEDSQEMKDLNNIINDIQPLTEENKENR ELYERTLSSCLCGSTKQCLTFFFGETATGKSTTKKLLQSSIGELFIETGQTILTDIIDKGPNPFISNMHLKRSVFCSELP DFSCSGSKKIKADNIKKLTEPCIVGRPCFSNRIHNKNHASIIIDTNYKPVFDKVDNALMRRIALVKFRTHFSQYSNSDSV KNNAAYDDVKPLDENLDMKIQKNYFRYAFLNLLVKWYQRYHIPTMRLFPTPEAIPDFVFQLRVGSLLIPSSSTHLKFMSS LSKIGYVLENDLMVLPLQLFQQKISKHFNIKVYGNDIESFITKHKKFANVSEEYLEYIFIEDIISK
>lcl|q1_ParFR155370760 | ref | YP_001426294.1 | hypothetical protein FR483_N662L [Paramecium bursaria Chlorella virus FR483]
MSEAYIISWCKKRGYYGRTGDLSHVLLDKGVLCVPDSSHEEFLSEYARGVVKGGKFSCVVEYKPKVFRMFYDLDIVATKT LAETMTSGTFSEEIDEILKEICGTTADLFDIGKTEVTLCVSNASKKVADGVKVGIHLTFSNIFVTSTVALHVRGKVLEKL EERNNPFVNKWEDIVDAAVHKGSGMRLPWASKPTEPNRVYVPKLSYTLERGADVREEQLAEIHHSFAATRSLLLNVSLRT RGALTKLVDSIADDSFESPSMAGSIQHSSLAEYSEIIKEVEKAIPKEYDGRVTGVLKTEFVYMFRHSSKYCANVERQHHS SNTYFLVSRSGLRQCCYSRKVDFEEKSCPCAKFRGELIELPRKVMTELFPETPPQTPRIVAKPMPADQAGFSLNKMEDYV TKVLKPAAKKSKPKTKTTKKSSVYAMFMP
>lcl|m6_Masvi_orf152 | strand-[114110..116821]903_aa | D5 family helicase-primase
MAAKRQSRDIFAFLDSFRVAKGIPCTHTSFSPSGRYAVEGAKNLKAFFEVYNNAVENGVTLCITEMPYKYHPLYVDVDFR FKDSGKKMPKRKYTKEHVVAVIRAYQNVIRVIVPEFDQTERMLSCLVLERSSPRLVEEQVKDGFHLFFPFFIVASNVQNV FMRQKVVKELVETGAFKDLEMLETEEKCIDSLKGKPWLMYGSTKPGNLGDFLEPYTISQVYSDELEEIDVDSLLGEEADE MDLEIPKDLPYILSIQRRREPTPIVRGIIPSEKKMTRRKRPARLTKTVDQIMADIAEVRNSRVLDMLDSSRAENYDDWMN VGWTLFNIGNGLPEALELWIDFSSRASNFDEKKCEYLWDTMEMKGKSIGSLYQMAKNDNPEKYNDWKKEKSSEAMKGAMT AAKPTHANIASLIHIKYSDRFVCADSKANVWYEFRGHRWHKMDDANELMRIISFELPEEFRVEINRLSAITGQSQDPNSQ LTIKKCVDIQSKLQMDGFSQGVMKMCKRLFLNEHFLSKLDENRDLLGMEDGVCDLKLGIFRDGSPDDYISMSTGISYKAL SEEDRSVIECREFLKKLFPNPRIRKCALRMVSSCMQGGNRNKRIYICTGKGNNGKSVFFSLLEYIFGQYLIKFPREMCLA GRAGNPSSARPELARAPGTRYGVIQEVHKNEKFNPGILKELSGNDSFFVRNLFEKGRDIKPMFTIFMMANKPPGVPGSDQ ATWNRIRLIPFEATFLSEQDENWIEDPELRREAKMFKADEHFEEKIPGLAHALLWLCVEDFRKYKEEGLCEPEEVEAATA KMRARNDTIRKYIRDCLIVDREKKEDDEKTFLTVSELFNHYKEWHDENFPSYAVRKTMTILKFRKQFARAVKIQPINGKK FEGLSFKEQENLEDDEGKGDED F
>lcl|u1_Shevi21492536 | ref | NP_659655.1 | NTPase; DNA replication [Sheeppox virus]
MASHLVNNEYIFVLKKIGVHTSHRESEDPRFVDIFTCEELENYILKNPSCTLFETLRDEEAYSVVRVFFDVDLDIVLDEI DYTAALEDFVLNVTKFVSIFSSRECSTNQNIVLKCMRSNFSLTKSTDTSRTSFHIVFPDTYTNMDTLIYMKKPLLEFLRS SENPLIRSIDPAVYRKKATLRIVGTRKNPNNDKIHIRQPPHNNISDYLFTYVNINEKSCYFTLSKKVDDKKTDVLWEPNY IHFNDAMKKVSKLIINEIVNINDFNVNNFTSIPIIIDYIMPCALCKKKIHKHHHQLTLGNGILKIFKAGNPHSCKVKAIA LEGNKLFTISQLIMDSNVIHLTERGDHVVWIKNSWKFNTDEPLITKLILNMKDQLPSEYIPDILCPRKRKVIENNLKDML VDTIETDTYPFMLPFKNGVLDICSGKFYKGAESKKFICTVSTGFNLDIEKYLNEDSQEMKDLNNIINDIQPLTEENKENR ELYERTLSSCLCGSTKQCLTFFFGETATGKSTTKKLLQSSIGELFIETGQTILTDIIDKGPNPFISNMHLKRSVFCSELP DFSCSGSKKIKADNIKKLTEPCIVGRPCFSNRIHNKNHASIIIDTNYKPVFDKVDNALMRRIALVKFRTHFSQYSNSDSV KNNAAYDDVKPLDENLDMKIQKNYFRYAFLNLLVKWYQKYHIPTMRLFPTPEAIPDFVFQLRVGSLLIPSSSTHLKFMSS LSKIGYVLENDLMVLPLQLFQQKISKHFNIKVYGNDIESFITKHKKFANVSEEYLEYIFIEDIISK
>lcl|l1_Aedta109287999 | ref | YP_654693.1 | hypothetical protein MIV121R [Invertebrate iridescent virus 3]
MNQLYSFFKNCNSFGAPPPLYTHVFLGSRPGKFYLSASSDNEFYTLYNSLVEAKTPVCVAEKQDDYVPLLGDVDLKVCID QENAFLKKTRVLYGEEELRAIVKCFQDTIKKNVVDWRDYHLICVALEKKPYMAGEYLKNGFHLHFPYLYLEKEKVKNVII PKIKEMVAAFRLGSGKRLFADIDDAPENFIDDVTNKCWLMYGSSKSEDKKPYRISQVYSGNLEPMDLYEAFSIKPFYTKE EEPITVTVDNVKKILPQLLSISSIKKEVLNVKTPMDLKIPTKIYLKQELKDIEGENSETIKRNLKDAKDLLKILNKKRAN EYNSWWDIGIILFNIGHGCEDAFTIWDKWSSYSDKYDPDACVQVWNSMHLRNPRFSKIKGMGSLRWYVKQDNLKGYTAWV DKMHGLVLDEKNLVECVTRLEIMTTDTPLARLMLDLYSGEYVFSDAGWYSFNGTIWSPVKVLKDFRVKFEHISTKYKEMR KRIMELIYHKNDDSGRDSEEDSQEEEVSSSQEQLSAKHRAILMAKYRDINRAINKLENFATQNGILKMCEVFFYNEDFSD LLDENPLLIAFKNGVFDFETLTFRKGLQSDYLSKTLNIRYDDTLTDDSEEVLELYNFLSKIFPDEKVRAYFVDQICEVFR GGNRDKIAMFWTGNGNNGKSVTQRLFETMIGKKLAVKLSTSVLTERIQPGQPNPQLTRLRGGIRWGVFDEWGKTEQILSG SLNVLTGGDSLPCRDLFQKGSDSSDFTPMFKLLCICNELPCLKDAVDATWDRIRIIPFESKFVAREKCPETEQEQREKKL FLCDTEITQKDRMESLARALGWYLVKIFKEKEKKRRNGTYQVTIPDKVNDAKLKYQAKCDILAFFMEETYLKTDNQDHKI PFDDMYISFKNWYINSFSGKMVTLNKHEFIEMVRNK YNLTETDKALRGYMWNRNYDDSDDE
>lcl|u1_Bovpa41057504 | ref | NP_957977.1 | ORF068 NTPase [Bovine papular stomatitis virus]
MAAPVCDNTHVFLLKRLGVPASCRRAEDPRFVEILTPYELSSYIERNPGCCLFETLRDEEDCSVVRIFADVDMDAAMEEE DFVAALEDLILELGSFFDRFASGSCGTVPGELKRCMLSGFTVTRSTAEHKTSFHLIFTDAYTTLDTLVAAKRPLLDLCRR SDNVLLRALDTAVYRRGATLRVVGTRKTPDATAVHLMQSPDDDIKDYLFTYVELSDTSVYFELSERERDCGASVVAWETS YIPFQDAMRRVSQAVVNDIVNLREITEDNFLNTPLVIDYATRCALCRKPRHKHAHHITMGNGCLRIVKGGNAHNCKVKII QLEGNRLFTAAQIIIASDVVKLTERGDYIVWLNNSWRFSSEESLITKLVLDVRHSLPADYANEMLCPRKRKVVETNIRDM LVDVSETDVLYDKLPFTNGVLDLATGEFLTGDRAKECVCTVSTGYRFSREEYEAAADSEAMRRLVSVIDDIQPNTPENAE NRALYERAMSSALCGATKTVIVFFFGDTMTGKSTSKRLLHSVLSGLYIETGQTVLTDVLDKGPNPFVANMHLRRAVFCSE LPDFACNNARKLRSDNFKKLTEPCIVGRPCFSNKIHNRNHATFIIDTNYRPVFDRVDNALMRRVALVRFRTHFSSAATRA AAVHNIEYSAVKDMDDSLDAKIQRNYFRYAFLRLLVEWFRKYHVPQVSLDATPDAVPDFAFHRRVAELVVPSNETHRRMM ETLSKLGYVLVNGNVAMPANVFQQRLAAHFNARVHGGDIEAFLFRHKKVVNVTEEYIEYVFIDDVENK
>lcl|q3_Ectsi13242517 | ref | NP_077530.1 | EsV-1-45 [Ectocarpus siliculosus virus 1]
MLKWLRDKDFINNSDMTTTQTVMTGGVVSVPDENYDEFLALYAEEVKSKNKTLSFSELRSDPVFCMYFDVDMLDTDVLGV EASSRIFSVIQSVIKSYYAGDQNDDRFRCVVCDTTVKKVPSSDGEIALTKNGYHVIYPNLRINLSQALQLRYSVVNELEK TLGPRADGMNAWSDVIDRAPYTSGLKMCGSFKRVKCTDCKKADPTFKDKKKALLAEMAKLRRKIFPREPGFDYTDLSDIH SDEFKDAVFGDKYGKYLDLTGFNSCKMCLNTGKVMEKRTYMPCLVLDGGGDVDVSLLDVLREDYFEVMKYTSIRCQDGEK ETRGFTIPKGVPRAPTEENGANMRSFSSKSLTHLGSDMRAFTVNNDMYLSDAQTMRLWKGPRVEDARRLSVIETFLRKNV CSAYSSVQIRKVFESKVKKVAQKPSGGNKMINALIGAHAGTTLPSTDVAVSNRYLVNVAGVGSTFCMNKGSEHTSNSVYF IITASQCFQRCFSKKSDIRSGGTTCADYRSGGFAVPSSVSSVLFPGEAVKTPAIASLALCPDHGVPKTFGNRGKKRRRME WGNKKL
>lcl|q1_Acatu155371001 | ref | YP_001426535.1 | hypothetical protein ATCV1_Z054L [Acanthocystis turfacea Chlorella virus 1]
MSVHVYEWCKKRGYYGRTGDLSHVLLDKGVLCVPENSHDEFLAEYARGVVQGGKYSCVVEYKPKVFRMFYDLDIVASPEL AEAMTKGDFSEDVHTVFKTVCGVTADLFEVDRTEVIMCASNFTKKAKDGVKVGIHLTFGSIFVTSPVALFVRSKVLEKLS DIKNPFVNDWEQIVDAAVHKGSGMRLPWAAKPEEPKRVYIPMLKYILDRKDEMRHELLDVSGFAATRKILADVSLRARGA LTKLLVDAELDDTESPSYSESLKHESLRQFETVVAELEKIIPEEYGGKITGVLKTDHVYMFRHSSKFCSNVGRHHHSSNT YFMVTKKGMHQRCYSRKVVFEEGLCPCSLYKGEVIKVPNKILDELFPQAPPEPKEKTVAPMPSQMSTLSYRVVEEYATRT PKVRKAPQKKPPKISLADLMKTTH
>lcl|u1_Vacvi66275907 | ref | YP_232992.1 | NTPase [Vaccinia virus]
MDAAIRGNDVIFVLKTIGVPSACRQNEDPRFVEAFKCDELERYIENNPECTLFESLRDEEAYSIVRIFMDVDLDACLDEI DYLTAIQDFIIEVSNCVARFAFTECGAIHENVIKSMRSNFSLTKSTNRDKTSFHIIFLDTYTTMDTLIAMKRTLLELSRS SENPLTRSIDTAVYRRKTTLRVVGTRKNPNCDTIHVMQPPHDNIEDYLFTYVDMNNNSYYFSLQQRLEDLVPDKLWEPGF ISFEDAIKRVSKIFINSIINFNDLDENNFTTVPLVIDYVTPCALCKKRSHKHPHQLSLENGAIRIYKTGNPHSCKVKIVP LDGNKLFNIAQRILDTNSVLLTERGDHIVWINNSWKFNSEEPLITKLILSIRHQLPKEYSSELLCPRKRKTVEANIRDML VDSVETDTYPDKLPFKNGVLDLVDGMFYSGDDAKKYTCTVSTGFKFDDTKFVEDSPEMEELMNIINDIQPLTDENKKNRE LYEKTLSSCLCGATKGCLTFFFGETATGKSTTKRLLKSAIGDLFVETGQTILTDVLDKGPNPFIANMHLKRSVFCSELPD FACSGSKKIRSDNIKKLTEPCVIGRPCFSNKINNRNHATIIIDTNYKPVFDRIDNALMRRIAVVRFRTHFSQPSGREAAE NNDAYDKVKLLDEGLDGKIQNNRYRFAFLYLLVKWYRKYHVPIMKLYPTPEEIPDFAFYLKIGTLLVSSSVKHIPLMTDL SKKGYILYDNVVTLPLTTFQQKISKYFNSRLFGHDIESFINRHKKFANVSDEYLQYIFIEDISSP
>lcl|u1_Yabli12085066 | ref | NP_073468.1 | 83R protein [Yaba-like disease virus]
MAGSISNNEHVFVLKSIGVPSSHRQSEDPRFVDIFTCEELESYIEKNPTCTLFETLRDEEAYSVVRVFFDVDLDAVLDEI DYIAALEDFILEITNFVSKFSVMECGANQNTVLKCMRSNFSLTKSSNKNKTSFHMIFPDTYTTINTLIAMKKPLLEFLRS SENPLIRSIDPAVYRRKATLRIVGTRKISNNDSIHLKQPPHDNISDYLFTYVKFHNNSCYFSLSKRLEDVLPSSLWEPNY IPFNEAIKKVSKIIMNDIINLKDLDINNFTTIPLVIDYVMPCALCKKKSHKHHHQLSLGNGMIKIYKAGNPHSCKVKAIM LEGNKLFTISQLIMDANVIRLTERGDHIVWIKNSWKFNNEEPVITKLVLNMKDQLPSEYTPDILCPRKRKVIENNLKDML VDTVETDTYPHILPFKNGVLDITSGKFYHGEESKKFICTASTDFNFEMDKFLNDTSIEMKELECIIDDIQPKTCENLKNR ELYERTLSSCLCGSTKQCITFFFGETATGKSTTKRLLQSAIGDLFIETGQTILTDLMDKGPNPFISNMHLKRSVFCSELP DFACSGSKKIRADNVKKLTEPCIVGRSCFSNKINNRNHASIIIDTNYKPIFDRVDCALMRRVSLVKFRTHFSQPSSAEAA KSNSAYDDVKPLDENLDMKIQKKYYRFAFLNMLVKWYQKYHVPTMRLFPTPDAVPDFAFQLKVSSIIVASSSTHLSLISK LSKIGYVIENDLIVLPSNIFQQKLAGHFNIKIHGHDIESFINRHKKFANVSEEYLEYIFIEDITSK
>lcl|q6_Ostvi163955059 | ref | YP_001648163.1 | hypothetical protein OsV5_086f [Ostreococcus virus OsV5]
MFKRWCTQQKFNNATNLSHVLMDGGVLSVPFDKLNEFHEKYIEAVRSGEKLFVVEQKSPQYNFFVDIDYKDTRSLTFDEI HDICKVICDKVKRHGGKDCLISVSPPKMAGQYTKTGVHLNWPGFVVDQRSAIALREHILVALSRAKGGTDWNEIIDVAVY GDIRRKSKGSGFRMPWSHKMAKHTPCGGQGCPECGGKGKIVQVAYLPLFMYNHGPLSKLTKIDPEPNLDILKMSSIRTDQ PQHITVEPPSSVIKEGSFTEAQTKDEIENDELKGLIEDFIQRNLEGQSTAVVTKLFKHKETYLVSTNSKYCENLRRAHSS NHVWFHISGQVIAQKCFCRCETIRGRRDGFCKDFYGRKHTLPPRVVEKLYPKREDLKKCPEIKKFEEKPQIKQSDVKQPL ESFIRRCMKCPEDTRVVSIARQKNGFTALTTSSYCETIGGDHQDCTMSYVIRDGKITQKCPVCTKSTARTHDLSGSVKEA LKKNNTQQ
>lcl|u1_Fowvi9634728 | ref | NP_039021.1 | ORF FPV058 NTPase, DNA replication [Fowlpox virus]
MALSVIRNNHIIFVLKQIGVRTKHRENNNSKYVESFTCDELERYIYSNPDCTLFETLKDEEYYSNVRVFFDVDMDGRLDD KYQATHNFVNIITKFVADYAYNDCKMISNHRDKDKMITDMKSNFSITESTDKEKTSFHLIFFNCYTTLDTLINMRKKLIV LTKESNNRLVKAIDTSVYRHKPSLRIVGTKKDSINIHVHKKTKQNIHFKNYLFTYVDYNEEDCYYFVSEQQHQSPDLLNW KEEYIPFHDAIKKISKAIGNSIINLKDITAENFTVTPLDIYYATPCNLCKKVSHKHPHHLLISNDCIRIYKSGNPNSCKI KTISLEGNKLFSISQQIIDLNVINVSDRGEYLVWLKNVWRMCEDDNNITKLILYMRDHLSSDCTDLLLCPRNRKVIEHNL KDMLIDTIETDTYPEKLQFLNGVYDIKDSIFYQGNDAKKFVCTVSTGYKYEEGINVDDITTELMSILDDIQPKTKENFEN RELYEQILSSCLMGTTKQCIFFFYGETATGKSTTKKLLKSVMHNMFLETGQVILTEQMDKGPNPFIANMHLKRVVFCSEL PDFSCNTSKKIRSDNIKKLTEPCVVGRSCYSNKINNRNHATIIIDTNYKPVFDKVDNAIMRRIALVNFKTHFTNTKKKVH NSKYDFIKPLNESLDSKIQSNYFRYAFLKILLGWFSKYHVPNLRILPTPDKIPDFKFRLKVESLIIPSNSTHVKYVDKLM KLGYITDDDGIPVLQLNIFQQKLSLHFNVKLYGQDIDSFIMKNKKYMNLADEYMSFIFIEDLNTINEPRNT
>lcl|l5_Ambti45686089 | ref | YP_003852.1 | D5 family NTPase [Ambystoma tigrinum virus]
MANTTIKYTTMDLYGILKSCKCSSDERLTHQSLSGGRFSVTGSKVGEFWRAVADRIESGEPIDISEARQKETPLTLDFDV VDKDCKDPVPDVLVNNIHAAVARWARSSLKPAPEDRDLCGVVLTKPVRRCAKGWKKGFHIQYPKLVLETGVAKNLVVGPA LRPICSKVWEAVAGTAKDYLDPLSCTVPWLVYGASKPDEPFAWKIARTLDHAGKTIDFNTAFGDVETPPSWGKPTSDRHR EAMVLSIHPAGRSVFFRRYDFTAANPGRVTRLADYSAVMAKLDVARQRKPAWNIDATKAHRLKRVTELTAMLTADLADDR QTWLNVGFCLWQQTSGSAEGYKVWLSFSKKSDKCDEDECWTIWNNQMRPNSFTEGTLVYLAQKHNPGAYLNWLQVKSTPV NDIGTNVAMAKIMWDYYGHQFVCCGGKTQTWYRFDGLTWVESNQGTDLRSLISAEGGPLRRLLTRQLDAVTAAKARGGRD SGNEDEDDEENSATDEDDSNPWDSELRRLDSEVLDAMVKRLRNNLKGIEMTGIKNNVLRECAELFYQPEFGDVIDSDPLL FAFANGVYDFREGCLRDGRPEDKLSRRAPVDFVMFGPIPKARHPDNSPVMRPKRMPGESVQDHARRLAECFEQDDVSASA GTMGKEDVESFSCNPEDFKGPVAKLLAFFASVFPDEGTRRFFLRNAAAIFVGGNPDKVVLFWTGTGNNGKTVTQTLFEKM LGCFAVKMSTQTLTGKKPSAGSANPEMARLGGGVRWAVMEEPNSDETINAGTLKSMTGNDSFFARDLYCAGKTTFEIKPM FKLHVICNALPGIKDADQATWNRVRVVPFESTFVTPGTTAPADSKYVFPADTDITRKLDRLTAPLAWYLVYCWACIQNER VKYVPPPKVMEATMAYQKEHDLFRQFTEEMLR KDLDSTLTCDDAYTAFRDWTSANSPHGTVRRPKGQVVKCLEAILGKKT VDGWPGYAVGAEQQE
>lcl|u1_Yabmo38229245 | ref | NP_938338.1 | 83R [Yaba monkey tumor virus]
MAGSISDNEHVFVLKSIGVPSSHRQSEDPRFVDIFTCQELESYIEKNPTCTLFETLRDEEAYSVVRVFFDVDLDAVLDEI DYIAALEDFILEITNFVSRFSVLECDANQNIVLKCMRSNFSLTKSTNKNKTSFHMIFPDAYTTINTLIAMKKPLLEFIRS SENPLVRSIDPAVYRRKATLRIVGTRKFSNNDSVHIKQPPHCDISDYLFTYVKFHSNSCYFSLSKRLEDVLPSSLWEPNY IPFNEAIKKVSKIIMNDIINLKDLDINNFTTIPLVIDYVMPCALCKKKLHKHHHQLSMGNGMIKIYKAGNPHSCKVKAIM LEGNKLFTISQLIMDANVIRLTERGDHIVWIKNSWKFNNEENVITKLVLNMKDQLPLEYTPDILCPRKRKVIENNLKDML VDTVETDTYPHILPFKNGVLDITSGSFYYGEESKKFICTVSTDFNFEMDKFLDNDSNEIKELTCIIDDIQPKTCENLKNR ELYERTLSSCLCGSTKQCITFFFGETATGKSTTKRLLQSAIGDLFIETGQTILTDLMDKGPNPFISNMHLKRSVFCSELP DFACSGSKKIRADNVKKLTEPCIVGRSCFSNKINNRNHASIIIDTNYKPIFDRVDCALMRRVSLIKFRTHFSQPTNVEAA KSNSAYDDVKPLDENLDMKIQKKCYRFAFLNMLVKWYQKYHVPTMRLFPTPDAVPDFAFQLKVSSIIVASSSTHINMISK LSKIGYVIENDLIVLPSNLFQQKLAGYFNVKVHGHDIESFINRHKKFANVSEEYLEYIFIEDITSK
>lcl|u1_Myxvi9633716 | ref | NP_051794.1 | m80R [Myxoma virus]
MAKALVDNEHIFVLKSIGVPNSHRQSEDPRFVDIFTCDELENYICNNPTCTLFETLRNEEDYSVVRVFFDVDLDVVLDEI DYVAALEDFILEVTKFVSVFSVKECDAPQNKVLKCMRSNFSITRTTDPDKTSFHMIFPDVYTTMHTLIAMKKPLLEFLRS SENPLIRSIDPAVYRRKTTLRVVGTRKAANNDKIHIKQPPHTNISDYLFTYVRMHRDSCYFSLTKRLDDTMSEALWEPNY IHFGDAMKKIAKAVVNEIINFKDLDVTNFTTVPLVIDYVMPCALCKKKTHKHHHMISIGNGMLKLYKAGNPHSCKVKTIL LEGNKLFTISQIIMDSNVIHLTDRGEYIVWLKNAWKFNTDDPIITKLVLNMKDQLPTEYVPDILCPRKRKVIENNLKDML VDVTETDVHPCILPFRNGVLDISNGTFYTGHDSKDFICTVSTGFNLNMEKFLDNDSEEMKELVSIINDIQPLTEENKQNR ELYERTLASCLCGTTKQCITFFFGETATGKSTTKKLLHSAIGSLFIETGQTILTEVMDKGPNPFIANMHLKRSVFCSELP DFACSTSKRIRADNIKKLTEPCIVGRQCFSNRINNKNHASIIIDTNYKPVFDRVDNALMRRISLVRFRTHFAQTATNKEM LNKAAYDDVKPLDETLDMKIQKNYYRYAFLNLLVQWYQKYHVPHLKLFSTPENVPDFAFQLKVESLIVSSSSTHTHLISS LSKIGYVMEDNLVVLPAPLFQQKLAKHFNVRVHGHDIESFITRHKKFANVKEEYLEYIFIEDITSK
>lcl|l4_Infsp19881514 | ref | NP_612331.1 | ORF109L [Infectious spleen and kidney necrosis virus]
MSLSGFLAADRQQFGDSGGSTHVSLTGGSYIIDDDKVTQLWAYLQDATEPLHLAECRAHDTMLTIDVDYRAPSSEQQLYG IDSHVMPLHREVMHLLGTCVTGGIRAEDCSFVLLEKLDGHGNVMPPQQCDSLGNVKQGFHMQYTKIIANTHALTEYIIKP LNAAFPDVDLLSCSNAWLLYGACKPGGVPYTVTGHYGADEQPLPGCAWQDYCFPASGNLAITGLETHDTMLRKMLSVVPY GRMRYKRRLRCLEHSRAPGPSITHQGQQQLMIQQQPQEPMDVSTAASTTTPADVRALVDMLPASAAADRNTWLKVGFCLY QVMDATEDGLRLWMSFSAKCPEKFNATVCHDMWERQMRPNTYTVATLRYLAKQYSTEAYDAWTHSQWMSAERLKLTHVSL ASIMYSALSTHYVCGNIKGELWYKFDNGVWNEKGMNVIRSLISNEAGPIHQVLNKFLAGVASGQVPEPDETFLKCLHRTT FMLGSSPFKSSVMRECAEQFYRDDFVQRLDTNPYMIAFSNGVYDFKTRTFRPGQPEDMLSRTLPVAYTVGGYGRYVDDIL SAATLDPLSNTYNVCALLDNIETVGNTMTAKQPLCDVIRFYNTTFPDPEVREYFLRQVSHVFVGGNADKVCLFWTGSGNN GKTVTQTMFEKMLGSFAVKLSTTVLTGRKPCVTSANPELARLRNGVRWAVMEEPNNDETINPGPLKSMTGNDSFFARDLW CSGKETSEIIPMFKLHCICNTLPDIKMADMATWNRVRVVPFEAVFVSGERLEEARRDVPVEQRDCVQVMDKYFVDKIPLL VEPMAWLLVQLWGVLQGEPADAYKTPRKVIQVTKEYEEANNYVRGFADAMMVHEPGASVTEMEVYREFKAYMTAYGMATT AGYSITKVMKDLVLYLKCRYDKRSGHLIDVMV RDMATATGR
>lcl|q1_ParAR157953763 | ref | YP_001498654.1 | hypothetical protein AR158_C573R [Paramecium bursaria Chlorella virus AR158]
MNKQVHIYEWAKKRGYYGRTGEISHLLLDKGVLCVPESASGDFNHEYAVGVIKGGKRPCLVEYKLKIFRMFYDLDILTTR ENAKKMTTGVFNDEIKNVFYTICIATAMMFDITKTIVTMCISNISKKKDDGVKVGIHLTFDNIFVTSPTALHVREKVLET LIYEHNPFENTWDSIVDISVFKGSGMRLPWSAKQDDPKRFYVPIIEYILDSENEGVVEKSLDNEEIIKSVSFVRDILNKV CLRSKGVLTKLRSPIVDIDDVSPSYSGSFSHPSLKEYIHVVEEIEKHIPEVYNGKITGVIRTDHVYMFRHTSKYCANVER EHTSSNTYFMVTKFGLRQCCYSRKEEDVGRKYCLCSRFRGEIIKLPKKLIEELFPEDIDDKAAAELKKLPPPTPIASKDS FLAIDNIIERAEASKKFVKKKFIPQKKQKYHTGSIISEVFGK
>lcl|q2_Emihu73852576 | ref | YP_293860.1 | hypothetical protein EhV106 [Emiliania huxleyi virus 86]
MSVVRTSLQELIHHKLDKHSTACPTHTFTSNNKDSHMRLPTHESVVTVISSYITDIRNDGSTRHPSHQIYEHLATECHKF YVDAKLPDDISSPLQLLKLMKTVLDEFASADKTEQCIILTDKTKRARFVWPRFLISPRDAAIIVTRLAAVFSGMDGIRSA SYRWKELFTHPSKYIPKRGHPILLMPYSTSTPACTLCNTKNERENCMNCNGSGKVFSPELSWVIRYNVTFDEHERRPFIT DIYDIPGVDLLIASSISSVYYTANETKPSEPDNTQITYPVGTPHCQHVDKKIKANGSLWGAKNKNAAPPEEGFVRYIQRL VRTTFPEFHSEVVVSVECILIDQKRKQIKVAVKGKGCNTCAGKRKDHKDSYIYFLITPQGIKQCCFSKEMVDGMQCKKRM DNKPFKPLPSDEIKRCFPTHIDTRSQQNLSVLNERENEIKILDINIVNLLSKQESNKRKANVLGEIV
>lcl|l3_Lymch51870034 | ref | YP_073585.1 | predicted ATPase [Lymphocystis disease virus - isolate China]
MEALLKDTRVGKGQIFTHVSMDGGKYLLDAYRYPAFWQAVVDSIKPLHLLETRYKESPLTLDFDIKEPQKTYDKEILKKL HDRIIKYLKEHLSAENRNLIGVFLHKPFQLLEDGTIKQSFHVHYPRIMMNIVDMQRLTQELKSECEFILGKDYLDPNGCK VCWFVYGACKPGDDPYSIKYVFDSSNKTGNFHHLLKDTLYPRCFGETEDSQTLIRFYLTIMPQDKEPYLISFKNVKPKLI DKILSRKAEAILNEETRPSKLKYLINLLPEECADDRDVWLETGFCVWQITDGSIEGYDVWTSFSKKSEKYNEDECFDLWY RQMRPNDFTIASLYWLIKKYNSEGFADYVRLYECPPSKYYTDGSHVGVAKIVHHHFGSEFKCVSIKNHVWYRYDGVTWAE CHVGVDLRRLISDSKAPILQTLDRQIKIVDDCLKGEETDEKYYQWQEELAQLTLEELEKLMDRLFKIKKSLRMTQFKNSV MRECEELFYDPLFAQKIDSDPYLIAFKNGVFDFKQKTFRAGRPEDYCCKKLNVNYINYGFSGPLSCDPADFNGPELKETL IFFQQVFPDVELRTFFIRQLASAFIGGNLEKICLFWTGSGNNGKTITQTLIEKMFGVFAVKLSTSVLTGKKLSTGQANPE LARTGGGVRWVVMEEPDNDERINAGILKNLTGNDTFWARDLYCAGKDTKEIIPMFKLHVICNNLPEIKYADQAVWNRVRV IPFESVFKPVEECPETYEERLKAKTFLVDVKFNEKLCKMTEPLAYYLIYYWLNMDRLNYNAPNKVLKATKEYRNENDLYK QFVDNNLITESGTILSDRLLYIKYKEWLNETHPYYIVPSRNKAIKKFVEVLGPLTDGAWINLNFV
>lcl|b1_Spofr115298601 | ref | YP_762453.1 | 94.9 kDa DNA primase/Poxvirus D5 family [Spodoptera frugiperda ascovirus 1a]
MYGSVKDVSSKTYLLSGAYHCKDSAPPRQVSPEFVLTTLFDPSSVERFGDAVYVANQLKDITWKCKPDDVEKWFATWTFY LSVRMSMYNAKRFFVKGTPSNDTARNEQARSVCKSPGREVDTYGPEELKSFRAYLKKCISILNPERSIDRNQWMRVYWAL KDCSKRGLLEYDEAFVCFDNFSSQWTHYNPQEIRDMWLKNDESIDDDRRITYRSLLFDAHKDDPSTYAKLTRAHKNELKR IRAARVDGANSTFVESEAVSNIGSGSRRRRRSTAVTDSYESNEEEESEYGHVERTDRDDDGGDDTHASLGYTDHELSAMD DSDYDIACMFVSGWERRVTMVARVMYQFNGNIWRPVRNDEALIRRELPLWFDKFNEYATDYVARLVASGRGDEIQDDDGD ESNAANNLLNATRRKFKSIHRKCKNSAPQSGVITQVRALNTHDAGAYKSTKMDDNDSIVAFKNVVFCRDTLTVRRGKPED MISRCLNCDYVPYEELADDVKKFVNDFLDSLFPDPEVREYFLLSVCQIFRGFNIFKQYVVWTGVGNNGKSVLIRMFECLL GPLMVKLSKSVLVCNKMDIGSVNPDMCKLQGVRLAVTDEIAGSADINVGQAKLLSGNGTFMARDLYMKSSEMEPIRAQFI PIIVCNALPSLREPDEAAWKRIHIVPFDSYFTNEPDGFLPHGVDRTRVQMCKADIDTEVVADKHLEGFASLLLKTYIDHE RASRTRFGSSQYGACLKVPERVKQLLKHHKMKQNPIFDLLECKFTYDPESNELLSYEKLCTMINDRRRTRGASMEDVKKW TLEVINWREYRHNETGLIGFVPMNNA
>lcl|u2_Amsmo9964401 | ref | NP_064869.1 | putative NTPase [Amsacta moorei entomopoxvirus]
MSDEYIYLQKSLNVTKESKIDLILNDKTSKDLVKISISKICRSILKYKDSNQPISEYHEFILDDITDYFKLFFDIDCKTE YEIDDVKKYIKEFKKFISYELYNIFSNNFDIENHNIDNIKKFIFNNIYYTLSDNPHKLSLHIFFNQILVSPTSFIQLKKY IINLRSKINNILINNIDLAPFRRNTQLRFIYSKKNDSEYFHSEHDYNIENIEDLKKYIITYKNFNEPHIIIKAKDNNLTN LDVIYPHIKYFRGPHFIRNISKELYNNYKITISDDSIQLFKKKHSAELDEIIDINLIFNTPDCKICGKNSLHKNNRIIKF TEQKIILFKSGNPRNCNTLKYDYPTLSGYELANFIRDLNIIKKIDSDAYVYWKNGKWAIVDNPYIFQGISNMILEKYRNN MLIQDIDYIIKKFFGEAKNRISANLSMNTDIICFNPYIIQFNNGVYDLKESKFYTGENAKKYIRLNYIKIDYKDIEDMSD EEKIKFENNYNILLKLFNLVIPKSNPKRIVFETNLSSVLHYCHKSVITILYGPTSGGKSTIKYLLRQLLFDMFLEPPIEF YQNYIPKNSPNSWLGKVEDKLVSFASEGDVNRNEVFLNKNIKQYTEQYILGRDLNKSKCVHKNTLTQFIDLNPKPMFSSV DPALVKRIAVIEINETQFVNEKLSRDTVNITSDNRNIVIADSTFDDKILNNEFTLPLFYILKKWSKKYHKDTVKLLYTPD FFDKQN
>lcl|n1_Acapo55819086_085 | ref | YP_142561.1 | helicase III/ VV D5-type ATPase (N-term) join (C-term) [Acanthamoeba polyphaga mimivirus]
MTSKTENKKSVSSKTGRTTNNSTNKKTTEKSVKNVKTVKNNVSIDKNHSIRKNNEWERLYAFMMKYRVKGEKGSNLPVTH TMCDAPYGKYNIPDDMRSKFLRLYENAIVAGFKPHITELHKEYGPIIIDLDFCQPKEHGKRYYTEITIRNVVKLYNSIIK KYLNVEHSSFVTYVSEKERPVLRNGEYHDGLHITYPYICTQPSLQFVMREEFIKLAKKYKIFQKIPLTNNLESVFDEGVI YKTGWLLYGSRKNENSYPYYVSHCFLSIRNELHDYIIPGDNLKSRENIRHFINTHSCRRFFSLNDLTPLAEGVDPLAIDA KLKKIKEKINNNTNNTNTHKNTAELGDHHFNFIKAVSEETLVEAKNLVKLFSVQRATDYHTWYQVGRCLSNIDHRLLEDW ITFSKKCPSKFKKEECERLWRNMNMKPSNYTMATLHYFASKDDPDKYFEMKKLKIDGLIKEGMEASHHTIAKLLIEKYKF IYKCASIKNGIWYEFRNHRWIEIDSAYTLRNLISEVLVNEYANRQRILFGEATRQDAENKKEKFNDAVNITKVIKQLNNN TFKIGVIKECADMHMILIFSRIMCRYAYDPNFLTNLDENNYLIGFENGVFDLEAGIFRDGCPDDCISLCTNYKYIEIDED DETFKNINGFLKKIQPDKSMREYILTLLSTCLSGTNSEESFYVLTGSGANGKSKLMELLKYTLGDLYKPMDIRLLTEKRS SSSSASPELADKKGIRACPFDEPKASDEINTGFMKIFTGGDTITARALYKEPIYFKPQFKPFLLCNELPTIKSDDDGTWR RLKVIPFLSKFIKHSEATKKMKKEGLPKNHFWADTSLSEKLPDWKQGFMCLLLKYFRKYRKHGLIHPKLVTQHTVEYRKK CDVFQDFIGDYLVRVDNTKKGISVMDLY QNMREWYKSNYTGKCPNAKDLRNYVQHRMPTYNKNADMLTCYVLKTEVNQAG ELIDDIDNITVVG
>lcl|q1_Parbu9632035 | ref | NP_048824.1 | hypothetical protein PBCV1_A468R [Paramecium bursaria Chlorella virus 1]
MNKQAHIYDWAKKRGFYGRTGEISHLLLDKGVLCVPESANGDFNHEYAKGVVMGGKRPCLVEYKLKIFRMFYDLDILTTR ENAKKMTTGVFTDEIKNVFYTICVATAMMFDITKTTVTMCISNIPKKKDDGVKVGVHLTFDNIFVTSPTALHVREKVLET LVCEHNPFDNTWDSIVDVSVFKGSGMRLPWSAKHDDPKRVYIPVVDYILDSENTGVVEEPLDNEEIVKSVSSVRNILNRV CLRSKGVPTKLRNQNIDIDDVSPSYSGSFSHPSLKQYAHVIEELERHIPEVYNGKISGVIRTEHVYMFRHTSKYCANVER EHTSSNAYFMVTKSGMKQCCYSRKEEDVGRKYCLCSQFRGDVIKLPKKLIEELFPEEVDDKSAELLKLPPPTPSSSKDSF LDIDNIVKRSAAIKKTIKKKPVSANKPVRKYHTGSVISEMFGK
>lcl|u1_Molco9629026 | ref | NP_044045.1 | MC094R [Molluscum contagiosum virus]
MARAVDGNEVIFVLKTLAVPADCRRREDPRFVEAFAPDELDAYIREHPRCTLFETLRDEEAYSVVRVFFDVDLGAPLPAH ELLPAFDGFIRALSRFVANFAVDECAAPASRAALARALRADFSLTRSTNPGKTSFHLVFRNLYTTLDTLVAMKRPLLALA RRADNPLLRALDPAVFRRGASLRVVGTRKTPDSPHVHARTPPHTRIQDYLFTFVDFSEKSCYFSLRPRRDAPEPIAWDHQ QLVPFADAMRKVCQVLGNEILNLHEFTEDNFTTTPLLLDYVTPCALCRKSAHKHPHHLALGNGALRIFKSGNPHSCRLKV IPLEGNRLFTIAQRILDANVINLTERGDYIVWLRNCWRFSGEESVITKLVLHMRDELAPEFALPLLCPRNRRVIEHNLRD MLVDAVETDVFPEKLPFADGVLDIADGSFHTGADAKDFMCTVSTGYRLERDARARDALAPARAELERVLDDIQPRSPGNA ENRALYEKVLASCLCGATKPCIFFFFGETATGKSTTKKLLQSALHGLFLETGQTILTDLMDKGPNPFLANMHLKRAVFCS ELPDFSCSGAKKIRADNVKRLTEPCLVGRPCYSNRINNRNHATIIIDTNYRPVFDKVDNALMRRVGLVRFRTHFSNRGAP ASRLYDTVKPLDAALDRKIQSHYFRFAFLELLLEWYQRHHAAALELEPTPDLIPDFCFQRRLDAVLLPSDSTHRRLMPQL AKLGYVLAGDDALGMPGALFQQRLAEHFNVRVFGQEIESFVQKNKKYVSVSEDYVEYIFVADLEKAKAETQ
>lcl|u1_Varvi9627616 | ref | NP_042139.1 | hypothetical protein VARVgp095 [Variola virus]
MDAVIRGNDVIFVLKTIGVPSVCRQNEDPRFVEAFKCDELERYIKNNPECTLFESLRDEEAYSIVRIFMDVDLDACLDEI DYLTAIQDFIIEVSNCVARFAFTECGAIHENVIKSMRSNFSLTKSTNRDKTSFHIIFLDTYTTMDTLIAMKRTLLELSRS SENPLTRSIDTAVYRKKTTLRVVGTRKNPNCDTIHVMQPPHDNIEDYLFTYVDMNNNSYYFSLQRRLEDLVPDKLWEPGF ISFEDAIKRVSKIFINSIINFNDLDENNFTTVPLVIDYVTPCALCKKRSHKHPHQLSLENDAIRIYKTGNPHSCKVKIVP LDGNKLFNIAQRILDTNSVLLTERGDHIVWINNSWKFNSEEPLITKLILSIRHQLPKEYSSELLCPRKRKTVEANIRDML VDSVETDTYPDKLPFKNGVLDLVDGMFYSGDDAKKYTCTVSTGFKFDDTKFVEDSPEMEELINIINDIQPLTDENKKNRE LYEKTLSSCLCGATKGCLTFFFGETATGKSTTKRLLKSAISDLFVETGQTILTDVLDKGPNPFIANMHLKRSVFCSELPD FACSGTKKIRSDNIKKLTEPCVIGRPCFSNKINNRNHATIIIDTNYKPVFDRIDNALMRRIAVVRFRTHFSQPSGREAAE NNDAYDKVKLLDEGLDGKIQNNRYRFAFLYLLVKWYRKYHVPIMKLYPTPEEIPDFAFYLKIGTLLVSSSVKHIPLMTDL SKKGYILHDNVVTLPLTTFQQKISKYFNSRLFGHDIESFINRHKKFANVSDEYLQYIFIEDISSP
>lcl|b1_Trini116326764 | ref | YP_803301.1 | hypothetical protein TNAV2c_gp078 [Trichoplusia ni ascovirus 2c]
MLPRILRRTDCEQTATLVALEHNTCDSIDVGKYAVDSIQYERFLEYYVDLVERGKANLAEIPSHCSPIRLDIDLKVLSNE TGTESFSPRPPSALYTKNDVINIVDCLHKAIKSMKTKNYQNDDAEGEQDGDDNDIAYILLEKPPRLDKQYVKHGFHIHTV NGWVTANALRSIISTMKNMIGDYTFKCGILAHDAIDDVTNKPWLMYGSTKASNMLPYLVTNAYKFEKTTNQWRSILPHDI LNVINDHSEFMNVEYTPNRWNDPKHHKGIILQTWIYALSIRMSVVNSKRFRIHIKSDNIDDEGASTSSSHAVKRTYSRRE AEEHYNEQHNVSQDDDDDDDNLPILSQRLLNSNADDYCNNLSIWLNALNISRATEQSDWMKTFWAILNCVDEGKITQDQG FHLFDEFSSRCNEKYDAMEVAHMWNQQLTEKNTKKRLARKAKITVGTIIHNLKKDNPVIWKNILSTTKNSSSSSSSTTTT KRRRLQNVESLPQPPLPPPPPPPPSESSSSNSSCYFRDESPLNDENEDEDIDFTILSDTDVDIANVFLKAWKKKIMYLDD VMFKFNGTLWKYAQEEDAFLRRALTVWVEKFKRIADDHVQELKQVEVNEAMAIVNDGGGSRNRTLPKKQPVTRAEYLQKV IDSIWRKCKNSNTQSGIVKAIKTICTTGAGHDEMVQMDNNENLTAFEDMVFCNETLTMRNGRPEDMLSRCLKCKYIPYEQ LEPEAIEFVNIFYSSLFPDKEICEYFQLSCSQIFGGRNVFKQYQVWTGVGNNGKSMCIKLFETMLGRLFSKLNKSVLTSL KHNIGAANPDMYRLRGVRMVVTDELAKSDELNVGQTKLLSGGDSFIARDLYQKSTQMATIKAQFIPIIVCNDLPLLRDPD EAAWRRERVIPFESYFAYSNELEIPEEIPKERIQM RDDNIMVKINKYMPAFASCLLKKYIDFEKLRRSSPYNDDCCEKIP AKVLLGIKRHRLQQNIIRIVIDTKFSYDPTSNEILTFERLCVLVNDHKRKGRPVELNEIIRTTRELSTLRNYECTQEGVI GLLPLY
>lcl|u1_Crovi115531777 | ref | YP_784303.1 | NTPase [Crocodilepox virus]
MELNNRVIFVLKRIGVSREQRASGNLNLCESFLVPELEEYIRARPECTLFECLKNEEENSRVRVFFDVDLREPLVAEQFA ESFKTFLLLLTKFLADFVFKHCAASVSGSSKRAFLVAARSRYSLSLSDDPEKVSFHLIFTDMYTSVRTLVAMRRFLSREV RSSVNPLMRAVDVAVYRRNPSLRVVGTRKTPECRYVHRMTASTDLADYLYTYVDVTPSSYVFEYAEAPAPDRAAAPGAVS MSFDKILVRLQTIVGNEITNLDRLNANTLPGTPLIIDYRFPCRLCGKASHKHPHHVAVQEDTLRIFKAGNPNSCRVKTVP LAQNKLFAISERIMEAGVVHKNKYGEYIAWIAGRWETETDNNHLTRLVLSMKDAVDDDEGLVLVPSNRRIIENNLKDMIT SCVATDLFPEKLQFDNGILDVATREFHRGEEGKDFVCTVSTGYEYAPTPAGDPAVTELRAVLDDIQPPTGGNAGNREVFE RVLSSCLCGVNKPYIFFFYGDTSSGKSTVKKLLRSVFDGLFTETSQCILVEPFDKGPNPYVSSIHLKRVTFCSELPDFSC NNVKKIRSDNVKKLTENCIVGRACFSNKISNCNVSTIIIDSNYKPVFDKVDNAIMRRIGLIHFKTHFSPNLNRPCLGNSY DVVKKLNAELESKIRTNYFRGAFLTLLLEWYAKHHLHGLSLEPTPELIPDFRFRLTLDTIIAPSDSTHAKHMPSLVRRGY HVSEAGLPALSADGFRTRLVSHFNVKIYGSDIDGFISKNKKYTNFCDEYMEYVFIEDLGSK
>lcl|u1_Deevi62637469 | ref | YP_227467.1 | NTPase (DNA replication) [Deerpox virus W-848-83]
MANSIINNEHIFVLKTIGVPASHRHNEDPRFVEIFTCDELEEYIKNNPTCTLFETLRDEEAYSVVRVFFDVDLDAILDEI DYIAALEDFILEVTKFVSVFATKECSSNQNMILKCMRSNFSITKSNDKNKTSFHMIFPDTYTTLNTLMAMKKPLLEFLRA SENPLIRSIDPAIYRRKASLRIVGTRKVANNDKIHVKQPPHTDISDYLFTYVKMHDKSCYFCLTKRLEDTMPNVLWEPNY IQFNEAMKKVSKTIINEIVNFKDLDVNNFTTVPLIIDYVMPCALCKKRAHKHHHQLALGNGMLKIYKAGNPHSCKVKTIT LEGNKLFTIAQIIMDSNVIHLTDRGDHIVWINNSWKFNSEESLITKLILNMKDQLPMEYGHDVLCPRKRKVIESNLRDML VDNIETDTYPCMLPFKNGILDISTGKFYTGPESKKFVCTVSTGFNLDVNIFSDENSKEMKELEKILNDIQPLTEENKKNR ELYERTLASCLCGSTKQCLTFFFGETATGKSTTKRLLQSAIGDLFIETGQTILTDVMDKGPNPFIANMHLKRSVFCSELP DFACSGSKKIRADNIKKLTEPCIVGRPCFSNRINNKNHASIIIDTNYKPIFDKVDNALMRRISLIRFRTHFTQKNGFETA RNNSAYSDIKQLDENLDIKIQKNYYRYQFLNLLVKWYQKYHIPTMRLFPTPDAVPDFEFQLKVTSLIVPSSSKHLPLISK LAKIGYVLENELIVLPSQLFQQKLANHFNIRVHGHDIESFIMRHKKFANISEEYLEYIFIEDITSK
>lcl|u1_Rabfi9633891 | ref | NP_051969.1 | gp080R [Rabbit fibroma virus]
MAKALIDNEHIFVLKSIGVPNSHRQSEDPRFVDIFTCDELENYICNNPTCTLFETLRNEEDYSVVRVFFDVDLDVVLDEI DYVAALEDFILEVTKFVSIFSVKECNAQQNKVLRCMRSNFSITRTTDTDKTSFHMIFPDTYTTMHTLIAMKKPLLEFLRS SENPLIRSIDPAVYRRKTTLRVVGTRKTVNNDKIHIKQPPHTDISDYLFTYVRMHQNSCYFSLTKRLDDTMSEALWEPNY IHFGDAMKKIAKAVVNEIINFKDLDVTNFTTVPLVIDYVMPCALCKKKMHKHHHMISIGNGMLKLYKAGNPHSCKVKTIL LEGNKLFTISQIIMDSNVIHLTDRGDYIVWIKNAWKFNTDDPIITKLVLNMKDQLPTEYVPDILCPRKRKVIENNLKDML VDVTETDVYPCILPFKNGVLDISNGTFYSGHESKDFICTVSTGFNLNMEKFLDDDSEEMKELVSIINDIQPLTEENKQNR ELYERTLSSCLCGTTKQCITFFFGETATGKSTTKKLLHSAIGNLFIETGQTILTEAMDKGPNPFIANMHLKRSVFCSELP DFACSTSRRIRADNIKKLTEPCIVGRQCFSNRINNKNHASIIIDTNYKPVFDRVDNAIMRRISLVRFRTHFAQTMTKKEM LNKSAYDDVKPLDETLDMKIQKNYYRYAFLNLLVQWYQKYHVPHLKLFSTPENVPDFAFQLKVESLIVSSSSTHTHLISS LSKIGYVMEDNLIVLPVPLFQQKLAKHFNVRVHGHDIESFIMRHKKFANVKEEYLEYIFIEDITSK
>lcl|l3_Lymdi13358409 | ref | NP_078717.1 | D5 family NTPase involved in DNA replication [Lymphocystis disease virus 1]
MLKDSIKTKSMETILKDTKVGKGQTFTHVSIEGGKYLLDAYRYPLFWQTVVNNKAIHLLETRYKESPITLDFDIKETQQI YTKEILKKLHKQIINYLKEYLNVADANLIGVFLHKPFKLTETNLIKQSFHLHYPKILMNVVDLQQLIIELKEECKTILNG DYLDLNSGKVCWFIYGASKVADDPYCIKYVFNEACKSVDFYTSLKGTLYPSCFGSTDDPRILACFYLTIMPQDKEPYLVT FKTVKLSLVDKIISKKANLLIEPLEKQSKLQKLIDLLPNECSNDRIIWLEIGFCLWQITDGSNEGFQLWLSFSKRSEKFN QDECFDIWFKQMKPNSFTIASLYWFIKKYNPIGFIDYIRLYKCSPAKYYTDGSHVGIAKIIHHHFKMEFKCSSIKNHTWF KYDDVVWAECHVGVNLRRIISDAKGPIFRVLNQQIIVISNLINNEELDDEYYIWQSKLIHLSTEELINFRTQLCKIKKSL RMTQFKNSVMRECEELFFDPLFNQKIDSNPYLMAFQNGVFDFKQKLFRQGRPDDYCSKKLTINYVDYGISQLLSCNPEDF INQGLKETLIFLEQVFPDIELRVFFIRQLASAFIGGNSEKICLFWTGSGNNGKTITQTLMEQMFGPFAVKLNTSVITGKK LPTGQANPELVRTGGGVRWAVMEEPDSDERINAGILKSLTGNDTFWARDLYCTGKDTKEIIPMFKLHVICNNLPEIKYAD QAVWNRVRVIPFESVFKLAEECPDTYKERLNQKIFPVDLKFSEKLSKLIEPLAYYLIYYWLNMDRLNYNPPTKVLNATKE YQNDNDIYKQFIDNNLIKQDNIILTERLLYIRYKDWLAETHPYYVVQSRNKAIKRFSDILGPLTNGAWFNLNLI
>lcl|u1_Canvi40556020 | ref | NP_955105.1 | CNPV082 NTPase, DNA replication [Canarypox virus]
MAPHVIRNNHIVFVLKKIGVSTKHRNNNDIRYVESFTCEELERYIAKNPGCTLFEALKNEELYSNIRVFFDVDMEGTLDD NSSAINDFMRVITKFIADYAFDSCKMNTEKDKQQMINDMKENFSITESTNTEKTSFHLIFFNCYTTVDTLINMGKKLLPL IKQSNNRLIKAIDTAVYRHNPSLRVVGTRKTPDNVYVHSKTDNRVPFKNYLFTYVDFKDDCYYFVDESNYNQSPDLLNWR DEYIPFHDAMKKVCKVIGNNILNLKEITPENLTEIPLNINYATPCNLCKKVSHKHPHKLLIDNDCIRIIKCGNPNNCKIK VIQLEGNKLFSISQQIIDLNVINISDRGEYLIWLKDVWRMCEDESNITKLILYMKDYISSDCTGLLLCPRNRKVIEHNLK DMLIDPIETDIYPEKLQFTNGVYDIKDSVFYQGNDAKNFVCTVSTGYKYEDKEDINGVIEELSKILDDIQPKTKENSENR ELYEQILSSCLMGTTKQCIFFFYGETATGKSTTKKLLKSVMHNMFLETGQVILTEQMDKGPNPFIANMHLKRAVFCSELP DFSCNTSKKIRSDNIKKLTEPCIVGRPCYSNKINNRNHATIIIDTNYKPVFDKVDNAIMRRIALVNFKTHFTNSRKKVYN TKYDFIKPLNEGLDSKIQSNYFRYAFLKILLGWYQKYHVPNLTILPTPDKIPDFKFRLKIDALIIPSSTTHIKYIKELSK LGYIIDEDGLPVLYVSTFQQKLQVYFNVKLYGHDIESFILKNKKYINFTDEYMSFIFIEDLNNINVSTDISNTE
>lcl|u1_Swivi18640166 | ref | NP_570240.1 | SPV080 putative NTPase [Swinepox virus]
MAGSLVNNEHIFVLKKIGVPSSLRQNEDPRFVDIFTCDELENYIHNNPTCTLFETLRDEEAYSIVRVFLDVDLDTILDEI DFTAALEDFILEVTKFVSLFASKECNSDMNHILKCMRSNFSLTKSTDINRTSFHMIFPDTYTTMNTLIAMKKPLLEFSRA SDNPLIRSIDTAVYRRKATLRIVGTRKSPTNDKIHIKQPPHDNISDYLFTYVSMHTCSCYFYLTQRLEDTMPSILWEPSY IHFKDAMKKVSKIIVNEIINFKDLTENNFTTIPLIIDYVMPCSLCKKKHHKHHHQLSLGNGMLKIYKAGNPHSCKVKAIT LEGNKLFTISQLIMDSNVIHLTDRGDHIVWIKNTWKFSTEESLITKLILSMKEQLPSEYIPDILCPRKRKAIENNLKDML VDNIETDTYPNMLPFKNGILNISTGEFYTGVESKDFICTVSTGFELDMEKFSDTESTEMKELETILNDIQPLTDENRCNR ELFEKILSSCLHGSTKQCITFFFGETATGKSTTKKLLRSSIGDLFIETGQTILTEVMDKGPNPFISNMHLKRSVFCSELP DFACSGSKKIRADNIKKLTETCIVGRACFSNKINNRNHATIIIDTNYKPIFDRVDNALMRRISLVKFRTHFTQPSSNIST RNSTAYDEIKPLDETLDLKIQRNNYRYPFLHLLVKWYRKYHLPTMVLYPTPEAVPDFEFQLKVGTLIIPSSSTHIQFISV LSTMGYVIENEMVVLPIQLFQQKLAKHFNIRTHGHDIESFINRHKKFANINDEYLEYIFIEDIPSK
>lcl|c1_Afrsw9628179 | ref | NP_042765.1 | pC962R [African swine fever virus]
MREESWEDHDTIQLTAQRKYLAEVQALETLLTRELSAFLTEPGSKKTNIINRITGKTYALPSTELLRLYEHLEQCRKQGA LMYFLERQGTYSGLMLDYDLKLNTNAVPPLEPPALSRLCHRIFVHIKNSSVLPEGSHKIHFFFTLKPEVVQGKYGFHVLI PGLKLAASTKKSIIGSLQHDATVQKILHEQGVANPESCLDPHSASVPSLLYGSSKLNHKPYQLKTGFELVFDSSDPDYIP IHQIKNIESYNLVSELSLTNEQGSLVRPVYCAADIAAEKEEEIPTDDHSLSILMLHDPEARYLHKILNLLPPEYYVEYPL WSNVVFALANTSANYRPLAEWFSQKCPEKWNTGGKEKLEKLWNDASRHTEKKITKRSIMYWAHKHAPQQYKEIVEQGYFS ILAEYVYSYNGMLEHYMIAKVIYAMMGNKFVVDVDSNGKYVWFEFVLPGQPMNQGEIWKWRKEVNPDELHIYISENFSRV MDRITEHIKYHLSQPHETNILNYYKKLLKAFERSKSKIFNDSFKKGVIRQAEFLFRQRSFIQTLDTNPHLLGVGNGVLSI ETIPAKLINHFHEHPIHQYTHICYVPFNPENPWTKLLLNALQDIIPELDARLWIMFYLSTAIFRGLKEALMLLWLGGGCN GKTFLMRLVAMVLGDHYASKLNISLLTSCRETAEKPNSAFMRLKGRGYGYFEETNKSEVLNTSRLKEMVNPGDVTARELN QKQESFQMTATMVAASNYNFIIDTTDHGTWRRLRHYRSKVKFCHNPDPGNPYEKKEDPRFIHEYIMDPDCQNAFFSILVY FWEKLQKEYNGQIKKVFCPTIESETEAYRKSQDTLHRFITERVVESPSAETVYNLSEVVTAYAEWYNANINVKRHIALEL SQELENSVLEKYLQWSPNKTRILKGCRILHKF ETLQPGESYIGVSTAGTLLNTPICEPKNKWWEWSPNLSAPPEKEASAP TP
>lcl|q3_Felsp197322470 | ref | YP_002154743.1 | hypothetical protein FeldSpV_gp121 [Feldmannia species virus]
MIPMMGIYRFLSIHGCFKSKSTPRTHTIMSGGVLYVAEEYYDEFLGVYAREIDEGNRTLTFSELKSEGVFRMYFDIDMVD SRELSADDFVSLSQCVLETLRKFYIDIDQDLFKCVVCTTKPKPLSDKDTFKNGCHLIFPFLNVTLEMALQLRFAAVRDLE TRFGRRSRDANPWCDVIDKAPYFNGLKMCGSVKTLTCSECGGKKKNVRKKPEVAAILRDIRNIRRKTYPRRDDPGFDYSN VMSIEKDEFKNEDLAELFSAYQDETGTLICPACGDKGWHLEDRFYMPAKVLHGDGSLAEADMEYLADNPHETMRWTSIRS RPSDRMTAGYTVPEGYTAPRTERPTNSLQILGAQLKSFSPGIYREAVNAEIFGSDAAGIKTWKGCEITAPKTLNLIAHEI RNYATVYQDLVVRQAFEMRVAKAVATSVVSSGSTRSKRGRAGSKALENMAVANKVPGRERRVLEVVARIFVRVAGTGSLY CMNKGAEHTSNSIFFWISQDGIAHKCFSRKDVLGQSGKRCKDFRSELKPISPGLANALFVMADPSKKRGEKRRSTWDTFC
>lcl|n2_Mamav_263699_266581 (reverse), 961 amino acids
MTSKTENKKSVSSKTGRTTNNSTNKKTTEKSVKNVKTVKNNVSIDKNHSIRKNNEWERLYAFMMKYRVKGEKGSNLPVTH TMCDAPYGKYNIPDDMRSKFLRLYENAIVAGFKPHITELHKEYGPIIIDLDFCQPKEHGKRYYTEITIRNVVKLYNSIIK KYLNVEHSSFVTYVSEKERPVLRNGEYHDGLHITYPYICTQPSLQFVMREEFIKLAKKYKIFQKIPLTNNLESVFDEGVI YKTGWLLYGSRKNENSYPYYVSHCFLSIRNELHDYIIPGDNLKSRENIRHFINTHSCRRFFSLNDLTPLAEGVDPLAIDA KLKKIKEKINNNTNNTNTHKNTAELGDHHFNFIKAVSEETLVEAKNLVKLFSVQRATDYHTWYQVGRCLSNIDHRLLEDW ITFSKKCPSKFKKEECERLWRNMNMKPSNYTMATLHYFASKDDPDKYFEMKKLKIDGLIKEGMEASHHTIAKLLIEKYKF IYKCASIKNGIWYEFRNHRWIEIDSAYTLRNLISEVLVNEYANRQRILFGEATRQDAENKKEKFNDAVNITKVIKQLNNN TFKNGVIKECADIAYDPNFLRNLDENNYLIGFENGVFDLEAGIFRDGCPDDCISLCTNYKYIEIDEDDETFKNINGFLKK IQPDKSMREYILTLLSTCLSGTISEESFYVLTGSGANGKSKLMELLKYTLGDLYKPMDIRLLTEKRSSSSSASPELADKK GIRACPFDEPKASDEINTGFMKIFTGGDTIAARALYKEPIYFKPQFKPFLLCNELPTIKSDDDGTWRRLKVIPFLSKFIK HSEATKKMKKEGLPKNHFWADTSLSEKLPDWKQGFMCLLLKYFRKYRKHGLIHPKLVTQHTVEYRKKCDVFQDFIGDYLV RVDNTKKGISVMDLYQNMREWYKSNYTGKCPNA KDLRNYVQHRMPTYNKNADMLTCYVLKTEVNQAGELIDDIDNITVVG
>lcl|l5_Singr56692689 | ref | YP_164147.1 | D5 family NTPase [Singapore grouper iridovirus]
MELNTLLRSCKCDLDERLTHQSQTGGRFNISGHNVKTLWSAIENRTEPFNLLETRQHETPLTLDFDVSGDSQEPLSDVLI CGIHTGFTRWARNSLKPSPSDHDLCGVLLTKPVRQTGDKWKKGFHLHYPKLIFETKTVKSLIVLPVLKPLFSKIWEAVMG YSGDHLDPQSCNVPWLLYGACKPDETEPWKIHKTLNADGKPIDFKTAFGDMALPESWGRPTSDRHREAMILSIHPVERQK YFRRYDFTANNPGALLRLTKYSAVRAKLDMVRQRKTCWKTDLTEFHKLKRFRELTGMLTGDIADDRQSWLHVGFCLWQQT QGSLEGYKIWLNFSKKSEKCDEDECWRIWNNQMRPNSFTEGTLVYMVQKHNPAAYLNWLQTKSTPVKDMGTNVAMAKIMW DYYGHEFVCCGAKNQIWYRFDGLTWVESNQGIDLRSLISADGGPLKRLLTRQLEAVKTALAQADGGNDSGISDVEEDEEL EETDEEDGDNGNPWASELRRLPKKKLKIIIARLKSNLKGIEMTGVKNNVLRECAELFYRPNFSDELDADPLLFAFSNGVY DFKEGCLRDGRPEDKLSRRAPIDFIAFAPIPSARHPGAKLRRRPKRQPGESVADHARRLAEFFEEDDDAAANCDPWSPTG ENCVFSCDPKDFSGPVARLLTFFSTVFPDEGTRRFFLRNAAQTFIGGNPDKVCLFWTGTGNNGKTVTQTLFEKMLGCFAV KMSTQTLTGRKPSAGAANPELARLGCGVRWAVMEEPNSDETINAGTLKSMTGNDSFFARDLYCAGKTTHEIKPLFKLHVI CNTLPAIKDADQATWNRVRVVPFEATFVTPGTKAPADAKYKFPADTDISRKLDRLTAPLAWYLVYCWSCMQNETVKYVPP AKVMEATMEYQKEHDLFRQFYDEKLHQ NPTACLSCDEAYAAFREWATLNCPHSFARRSKTQIVKCLETILGKKGPTGWQG IELAAEQV
>lcl|q1_ParNY157952937 | ref | YP_001497829.1 | hypothetical protein NY2A_B633R [Paramecium bursaria Chlorella virus NY2A]
MSRQVHIYEWAKKRKYFGRTGEISHLLLDKGVLCVPESANGDFNHEYAVGVIKGGKLPCLVEYKLKIFRMFYDLDIITTR ENAKKMTTGMFTDEIKNVFYAICIATAMMFDITKTTVTMCISNIPKKKDDGVKVGIHLTFDNIFVTSPTALHVREKVLET LVYEHNPFENTWDSIVDISVFKGSGMRLPWSAKHDDPKRIYIPIFEYILDSGNENVVEIPLDNEKIIKSISSVRDILNKV CLRSKGVLTKLRIPIVDIDDVSPSYSGTFSHPSLKEYVHVIEEIDKHIPEIYEGKITGVIRTEHVFMFRHSSKYCANVER HHTSSNTYFMVTKFGLRQCCYSRKDEDVGRKYCLCSRFRGEIIK

D5_helicase_primase_x

>lcl|u1_Lumsk15150522 | ref | NP_150517.1 | LSDV083 putative NTPase [Lumpy skin disease virus NI-2490]
MASHLVNNEYIFVLKKIGVHTSHRESEDPRFVDIFTCEELENYILKNPSCTLFETLRDEEAYSVVRVFFDVDLDIVLDEI DYTAALEDFILNVTKFVSIFSSRECGTNQNIVLKCMRSNFSLTKSTDTSRTSFHIVFPDTYTNMDTLIYMKKPLLEFLRS SENPLIRSIDPAVYRRKATLRIVGTRKNPNNDKIHIRQPPHNNISDYLFTYVNMNEKSCYFTLSKKVDDKKADVLWEPNY IHFNDAMKKVSKIIINEIVNINDFNVNNFTSIPIIIDYIMPCALCKKKIHKHHHQLTLGNGILKIFKAGNPHSCKVKAIA LEGNKLFTISQLIIDSNVIHLTERGDHVVWIKNSWKFNTDEPLITKLILNMKDQLPSEYIPDILCPRKRKVIENNLKDML VDTIETDTYPFMLPFKNGVLDICSGKFYKGAESKKFICTVSTGFNLDIEQYLNEDSQEMKDLNNIINDIQPLTEENKENR ELYERTLSSCLCGSTKQCLTFFFGETATGKSTTKKLLQSSIGELFIETGQTILTDIIDKGPNPFISNMHLKRSVFCSELP DFSCSGSKKIKADNIKKLTEPCIVGRPCFSNRIHNKNHASIIIDTNYKPVFDKVDNALMRRIALVKFRTHFSQYSNSDSV KNNAAYDDVKPLDENLDMKIQKNYFRYAFLNLLVKWYQKYHIPTMRLFPTPEAIPDFVFQLRVGSLLIPSSSTHLKFMSS LSKIGYVLENDLMVLPLQLFQQKISKHFNIKVYGNDIESFITKHKKFANVSEEYLEYIFIEDIISK
>lcl|l2_Invir15078896 | ref | NP_149647.1 | 184R [Invertebrate iridescent virus 6]
MTDVFKVLTPAKNINGEHTHVSMGDTKGTWYLSLNKSQEFYNVYGLALKNGQKLSLAEKPGEYVPLLVDIDLKKEVNGYP NYGSNDFYNDEDIINVVKIFQNAVSENVNRHAKKLTNKNLRCVVLEKDIFIERINESEDKYIVKKGIHLHFPHLFLPKKD IKNSFMPVVKTMIDQENVFQDFINSMDNQIMPSSLIDDISSKYWLMYGSSKEGLNKPYKISKILDHNQQEISISKCFKSE TCIDGSPITDTNVEFELPMLLSINPKPSIISNKLFYFKEAPVKLCDALLPVVNNNREKEGRMSSREIEKMKKLTSFLSVS RADDYNQWWTVGITLFNIGTGRDCEEEALEAWKMFSSQSTKYDESRCDLEWAEMKKKNRPLNARTMGSLIFMAKSDNPVA LEKYLLAEQMNIENWTSHQNLDVESIKKLKVPVFDTEIAEMFVSQHEDEYLNGNLGWFKFNGTIWSSLESVGRHMRPSLV SLSRSYLNLIPALKYITKTLQNDDEGYEPSDSGFGFDDDDSASTSGGKTTAEITKLVNSKIKLINDLAKKCQNNGPQMSL MKVIEDMIGIDNLNDKMDQNKQLIAFTNGVYDLSLFTFRQGLPEDYITRQMTIPYDITLTMENPKVIKMLNFFKKIFPDE ELFEYFMLENCEMYIGGNRDKILQIWTGEGDNGKSVTNKIIENKFGKLSVKFPKGMVTGDPPKAGACFPELTRAQRGVRW AVVDEFAPDETVNAGVIKNLTGGIDNLYARDIQQKGKDVIDIDPFFKLIFICNTIPNIRNPDNATWNRIRVIPFESTFKD SIDDISLEEQKRDKIFLKDTSFCEKETIRELGEAFAWYLIQVFIKKEQARRDARLNGKSFKIKIPAKVNEATELYKAQGN AIADYFNDKFEISDDDNDTINIKLYYQDFLLWFSQT HSNKNVNIDKKKFMKLFVQHAKGDMNTFICTKLKLKETLEEFNL ENNEENGMPLF

D5_hel_prim_phycodna

>lcl|u1_Lumsk15150522 | ref | NP_150517.1 | LSDV083 putative NTPase [Lumpy skin disease virus NI-2490]
MASHLVNNEYIFVLKKIGVHTSHRESEDPRFVDIFTCEELENYILKNPSCTLFETLRDEEAYSVVRVFFDVDLDIVLDEI DYTAALEDFILNVTKFVSIFSSRECGTNQNIVLKCMRSNFSLTKSTDTSRTSFHIVFPDTYTNMDTLIYMKKPLLEFLRS SENPLIRSIDPAVYRRKATLRIVGTRKNPNNDKIHIRQPPHNNISDYLFTYVNMNEKSCYFTLSKKVDDKKADVLWEPNY IHFNDAMKKVSKIIINEIVNINDFNVNNFTSIPIIIDYIMPCALCKKKIHKHHHQLTLGNGILKIFKAGNPHSCKVKAIA LEGNKLFTISQLIIDSNVIHLTERGDHVVWIKNSWKFNTDEPLITKLILNMKDQLPSEYIPDILCPRKRKVIENNLKDML VDTIETDTYPFMLPFKNGVLDICSGKFYKGAESKKFICTVSTGFNLDIEQYLNEDSQEMKDLNNIINDIQPLTEENKENR ELYERTLSSCLCGSTKQCLTFFFGETATGKSTTKKLLQSSIGELFIETGQTILTDIIDKGPNPFISNMHLKRSVFCSELP DFSCSGSKKIKADNIKKLTEPCIVGRPCFSNRIHNKNHASIIIDTNYKPVFDKVDNALMRRIALVKFRTHFSQYSNSDSV KNNAAYDDVKPLDENLDMKIQKNYFRYAFLNLLVKWYQKYHIPTMRLFPTPEAIPDFVFQLRVGSLLIPSSSTHLKFMSS LSKIGYVLENDLMVLPLQLFQQKISKHFNIKVYGNDIESFITKHKKFANVSEEYLEYIFIEDIISK
>lcl|l2_Invir15078896 | ref | NP_149647.1 | 184R [Invertebrate iridescent virus 6]
MTDVFKVLTPAKNINGEHTHVSMGDTKGTWYLSLNKSQEFYNVYGLALKNGQKLSLAEKPGEYVPLLVDIDLKKEVNGYP NYGSNDFYNDEDIINVVKIFQNAVSENVNRHAKKLTNKNLRCVVLEKDIFIERINESEDKYIVKKGIHLHFPHLFLPKKD IKNSFMPVVKTMIDQENVFQDFINSMDNQIMPSSLIDDISSKYWLMYGSSKEGLNKPYKISKILDHNQQEISISKCFKSE TCIDGSPITDTNVEFELPMLLSINPKPSIISNKLFYFKEAPVKLCDALLPVVNNNREKEGRMSSREIEKMKKLTSFLSVS RADDYNQWWTVGITLFNIGTGRDCEEEALEAWKMFSSQSTKYDESRCDLEWAEMKKKNRPLNARTMGSLIFMAKSDNPVA LEKYLLAEQMNIENWTSHQNLDVESIKKLKVPVFDTEIAEMFVSQHEDEYLNGNLGWFKFNGTIWSSLESVGRHMRPSLV SLSRSYLNLIPALKYITKTLQNDDEGYEPSDSGFGFDDDDSASTSGGKTTAEITKLVNSKIKLINDLAKKCQNNGPQMSL MKVIEDMIGIDNLNDKMDQNKQLIAFTNGVYDLSLFTFRQGLPEDYITRQMTIPYDITLTMENPKVIKMLNFFKKIFPDE ELFEYFMLENCEMYIGGNRDKILQIWTGEGDNGKSVTNKIIENKFGKLSVKFPKGMVTGDPPKAGACFPELTRAQRGVRW AVVDEFAPDETVNAGVIKNLTGGIDNLYARDIQQKGKDVIDIDPFFKLIFICNTIPNIRNPDNATWNRIRVIPFESTFKD SIDDISLEEQKRDKIFLKDTSFCEKETIRELGEAFAWYLIQVFIKKEQARRDARLNGKSFKIKIPAKVNEATELYKAQGN AIADYFNDKFEISDDDNDTINIKLYYQDFLLWFSQT HSNKNVNIDKKKFMKLFVQHAKGDMNTFICTKLKLKETLEEFNL ENNEENGMPLF

DEAD_SNF2_like_helicase

>lcl|u1_Lumsk15150522 | ref | NP_150517.1 | LSDV083 putative NTPase [Lumpy skin disease virus NI-2490]
MASHLVNNEYIFVLKKIGVHTSHRESEDPRFVDIFTCEELENYILKNPSCTLFETLRDEEAYSVVRVFFDVDLDIVLDEI DYTAALEDFILNVTKFVSIFSSRECGTNQNIVLKCMRSNFSLTKSTDTSRTSFHIVFPDTYTNMDTLIYMKKPLLEFLRS SENPLIRSIDPAVYRRKATLRIVGTRKNPNNDKIHIRQPPHNNISDYLFTYVNMNEKSCYFTLSKKVDDKKADVLWEPNY IHFNDAMKKVSKIIINEIVNINDFNVNNFTSIPIIIDYIMPCALCKKKIHKHHHQLTLGNGILKIFKAGNPHSCKVKAIA LEGNKLFTISQLIIDSNVIHLTERGDHVVWIKNSWKFNTDEPLITKLILNMKDQLPSEYIPDILCPRKRKVIENNLKDML VDTIETDTYPFMLPFKNGVLDICSGKFYKGAESKKFICTVSTGFNLDIEQYLNEDSQEMKDLNNIINDIQPLTEENKENR ELYERTLSSCLCGSTKQCLTFFFGETATGKSTTKKLLQSSIGELFIETGQTILTDIIDKGPNPFISNMHLKRSVFCSELP DFSCSGSKKIKADNIKKLTEPCIVGRPCFSNRIHNKNHASIIIDTNYKPVFDKVDNALMRRIALVKFRTHFSQYSNSDSV KNNAAYDDVKPLDENLDMKIQKNYFRYAFLNLLVKWYQKYHIPTMRLFPTPEAIPDFVFQLRVGSLLIPSSSTHLKFMSS LSKIGYVLENDLMVLPLQLFQQKISKHFNIKVYGNDIESFITKHKKFANVSEEYLEYIFIEDIISK
>lcl|l2_Invir15078896 | ref | NP_149647.1 | 184R [Invertebrate iridescent virus 6]
MTDVFKVLTPAKNINGEHTHVSMGDTKGTWYLSLNKSQEFYNVYGLALKNGQKLSLAEKPGEYVPLLVDIDLKKEVNGYP NYGSNDFYNDEDIINVVKIFQNAVSENVNRHAKKLTNKNLRCVVLEKDIFIERINESEDKYIVKKGIHLHFPHLFLPKKD IKNSFMPVVKTMIDQENVFQDFINSMDNQIMPSSLIDDISSKYWLMYGSSKEGLNKPYKISKILDHNQQEISISKCFKSE TCIDGSPITDTNVEFELPMLLSINPKPSIISNKLFYFKEAPVKLCDALLPVVNNNREKEGRMSSREIEKMKKLTSFLSVS RADDYNQWWTVGITLFNIGTGRDCEEEALEAWKMFSSQSTKYDESRCDLEWAEMKKKNRPLNARTMGSLIFMAKSDNPVA LEKYLLAEQMNIENWTSHQNLDVESIKKLKVPVFDTEIAEMFVSQHEDEYLNGNLGWFKFNGTIWSSLESVGRHMRPSLV SLSRSYLNLIPALKYITKTLQNDDEGYEPSDSGFGFDDDDSASTSGGKTTAEITKLVNSKIKLINDLAKKCQNNGPQMSL MKVIEDMIGIDNLNDKMDQNKQLIAFTNGVYDLSLFTFRQGLPEDYITRQMTIPYDITLTMENPKVIKMLNFFKKIFPDE ELFEYFMLENCEMYIGGNRDKILQIWTGEGDNGKSVTNKIIENKFGKLSVKFPKGMVTGDPPKAGACFPELTRAQRGVRW AVVDEFAPDETVNAGVIKNLTGGIDNLYARDIQQKGKDVIDIDPFFKLIFICNTIPNIRNPDNATWNRIRVIPFESTFKD SIDDISLEEQKRDKIFLKDTSFCEKETIRELGEAFAWYLIQVFIKKEQARRDARLNGKSFKIKIPAKVNEATELYKAQGN AIADYFNDKFEISDDDNDTINIKLYYQDFLLWFSQT HSNKNVNIDKKKFMKLFVQHAKGDMNTFICTKLKLKETLEEFNL ENNEENGMPLF

DEAD_SNF2_like_helicase_c3

>lcl|u1_Lumsk15150522 | ref | NP_150517.1 | LSDV083 putative NTPase [Lumpy skin disease virus NI-2490]
MASHLVNNEYIFVLKKIGVHTSHRESEDPRFVDIFTCEELENYILKNPSCTLFETLRDEEAYSVVRVFFDVDLDIVLDEI DYTAALEDFILNVTKFVSIFSSRECGTNQNIVLKCMRSNFSLTKSTDTSRTSFHIVFPDTYTNMDTLIYMKKPLLEFLRS SENPLIRSIDPAVYRRKATLRIVGTRKNPNNDKIHIRQPPHNNISDYLFTYVNMNEKSCYFTLSKKVDDKKADVLWEPNY IHFNDAMKKVSKIIINEIVNINDFNVNNFTSIPIIIDYIMPCALCKKKIHKHHHQLTLGNGILKIFKAGNPHSCKVKAIA LEGNKLFTISQLIIDSNVIHLTERGDHVVWIKNSWKFNTDEPLITKLILNMKDQLPSEYIPDILCPRKRKVIENNLKDML VDTIETDTYPFMLPFKNGVLDICSGKFYKGAESKKFICTVSTGFNLDIEQYLNEDSQEMKDLNNIINDIQPLTEENKENR ELYERTLSSCLCGSTKQCLTFFFGETATGKSTTKKLLQSSIGELFIETGQTILTDIIDKGPNPFISNMHLKRSVFCSELP DFSCSGSKKIKADNIKKLTEPCIVGRPCFSNRIHNKNHASIIIDTNYKPVFDKVDNALMRRIALVKFRTHFSQYSNSDSV KNNAAYDDVKPLDENLDMKIQKNYFRYAFLNLLVKWYQKYHIPTMRLFPTPEAIPDFVFQLRVGSLLIPSSSTHLKFMSS LSKIGYVLENDLMVLPLQLFQQKISKHFNIKVYGNDIESFITKHKKFANVSEEYLEYIFIEDIISK
>lcl|l2_Invir15078896 | ref | NP_149647.1 | 184R [Invertebrate iridescent virus 6]
MTDVFKVLTPAKNINGEHTHVSMGDTKGTWYLSLNKSQEFYNVYGLALKNGQKLSLAEKPGEYVPLLVDIDLKKEVNGYP NYGSNDFYNDEDIINVVKIFQNAVSENVNRHAKKLTNKNLRCVVLEKDIFIERINESEDKYIVKKGIHLHFPHLFLPKKD IKNSFMPVVKTMIDQENVFQDFINSMDNQIMPSSLIDDISSKYWLMYGSSKEGLNKPYKISKILDHNQQEISISKCFKSE TCIDGSPITDTNVEFELPMLLSINPKPSIISNKLFYFKEAPVKLCDALLPVVNNNREKEGRMSSREIEKMKKLTSFLSVS RADDYNQWWTVGITLFNIGTGRDCEEEALEAWKMFSSQSTKYDESRCDLEWAEMKKKNRPLNARTMGSLIFMAKSDNPVA LEKYLLAEQMNIENWTSHQNLDVESIKKLKVPVFDTEIAEMFVSQHEDEYLNGNLGWFKFNGTIWSSLESVGRHMRPSLV SLSRSYLNLIPALKYITKTLQNDDEGYEPSDSGFGFDDDDSASTSGGKTTAEITKLVNSKIKLINDLAKKCQNNGPQMSL MKVIEDMIGIDNLNDKMDQNKQLIAFTNGVYDLSLFTFRQGLPEDYITRQMTIPYDITLTMENPKVIKMLNFFKKIFPDE ELFEYFMLENCEMYIGGNRDKILQIWTGEGDNGKSVTNKIIENKFGKLSVKFPKGMVTGDPPKAGACFPELTRAQRGVRW AVVDEFAPDETVNAGVIKNLTGGIDNLYARDIQQKGKDVIDIDPFFKLIFICNTIPNIRNPDNATWNRIRVIPFESTFKD SIDDISLEEQKRDKIFLKDTSFCEKETIRELGEAFAWYLIQVFIKKEQARRDARLNGKSFKIKIPAKVNEATELYKAQGN AIADYFNDKFEISDDDNDTINIKLYYQDFLLWFSQT HSNKNVNIDKKKFMKLFVQHAKGDMNTFICTKLKLKETLEEFNL ENNEENGMPLF

DEAD_SNF2_like_helicase_l4

>lcl|u1_Lumsk15150522 | ref | NP_150517.1 | LSDV083 putative NTPase [Lumpy skin disease virus NI-2490]
MASHLVNNEYIFVLKKIGVHTSHRESEDPRFVDIFTCEELENYILKNPSCTLFETLRDEEAYSVVRVFFDVDLDIVLDEI DYTAALEDFILNVTKFVSIFSSRECGTNQNIVLKCMRSNFSLTKSTDTSRTSFHIVFPDTYTNMDTLIYMKKPLLEFLRS SENPLIRSIDPAVYRRKATLRIVGTRKNPNNDKIHIRQPPHNNISDYLFTYVNMNEKSCYFTLSKKVDDKKADVLWEPNY IHFNDAMKKVSKIIINEIVNINDFNVNNFTSIPIIIDYIMPCALCKKKIHKHHHQLTLGNGILKIFKAGNPHSCKVKAIA LEGNKLFTISQLIIDSNVIHLTERGDHVVWIKNSWKFNTDEPLITKLILNMKDQLPSEYIPDILCPRKRKVIENNLKDML VDTIETDTYPFMLPFKNGVLDICSGKFYKGAESKKFICTVSTGFNLDIEQYLNEDSQEMKDLNNIINDIQPLTEENKENR ELYERTLSSCLCGSTKQCLTFFFGETATGKSTTKKLLQSSIGELFIETGQTILTDIIDKGPNPFISNMHLKRSVFCSELP DFSCSGSKKIKADNIKKLTEPCIVGRPCFSNRIHNKNHASIIIDTNYKPVFDKVDNALMRRIALVKFRTHFSQYSNSDSV KNNAAYDDVKPLDENLDMKIQKNYFRYAFLNLLVKWYQKYHIPTMRLFPTPEAIPDFVFQLRVGSLLIPSSSTHLKFMSS LSKIGYVLENDLMVLPLQLFQQKISKHFNIKVYGNDIESFITKHKKFANVSEEYLEYIFIEDIISK
>lcl|l2_Invir15078896 | ref | NP_149647.1 | 184R [Invertebrate iridescent virus 6]
MTDVFKVLTPAKNINGEHTHVSMGDTKGTWYLSLNKSQEFYNVYGLALKNGQKLSLAEKPGEYVPLLVDIDLKKEVNGYP NYGSNDFYNDEDIINVVKIFQNAVSENVNRHAKKLTNKNLRCVVLEKDIFIERINESEDKYIVKKGIHLHFPHLFLPKKD IKNSFMPVVKTMIDQENVFQDFINSMDNQIMPSSLIDDISSKYWLMYGSSKEGLNKPYKISKILDHNQQEISISKCFKSE TCIDGSPITDTNVEFELPMLLSINPKPSIISNKLFYFKEAPVKLCDALLPVVNNNREKEGRMSSREIEKMKKLTSFLSVS RADDYNQWWTVGITLFNIGTGRDCEEEALEAWKMFSSQSTKYDESRCDLEWAEMKKKNRPLNARTMGSLIFMAKSDNPVA LEKYLLAEQMNIENWTSHQNLDVESIKKLKVPVFDTEIAEMFVSQHEDEYLNGNLGWFKFNGTIWSSLESVGRHMRPSLV SLSRSYLNLIPALKYITKTLQNDDEGYEPSDSGFGFDDDDSASTSGGKTTAEITKLVNSKIKLINDLAKKCQNNGPQMSL MKVIEDMIGIDNLNDKMDQNKQLIAFTNGVYDLSLFTFRQGLPEDYITRQMTIPYDITLTMENPKVIKMLNFFKKIFPDE ELFEYFMLENCEMYIGGNRDKILQIWTGEGDNGKSVTNKIIENKFGKLSVKFPKGMVTGDPPKAGACFPELTRAQRGVRW AVVDEFAPDETVNAGVIKNLTGGIDNLYARDIQQKGKDVIDIDPFFKLIFICNTIPNIRNPDNATWNRIRVIPFESTFKD SIDDISLEEQKRDKIFLKDTSFCEKETIRELGEAFAWYLIQVFIKKEQARRDARLNGKSFKIKIPAKVNEATELYKAQGN AIADYFNDKFEISDDDNDTINIKLYYQDFLLWFSQT HSNKNVNIDKKKFMKLFVQHAKGDMNTFICTKLKLKETLEEFNL ENNEENGMPLF

DNA_topoisomerase

>lcl|u1_Lumsk15150522 | ref | NP_150517.1 | LSDV083 putative NTPase [Lumpy skin disease virus NI-2490]
MASHLVNNEYIFVLKKIGVHTSHRESEDPRFVDIFTCEELENYILKNPSCTLFETLRDEEAYSVVRVFFDVDLDIVLDEI DYTAALEDFILNVTKFVSIFSSRECGTNQNIVLKCMRSNFSLTKSTDTSRTSFHIVFPDTYTNMDTLIYMKKPLLEFLRS SENPLIRSIDPAVYRRKATLRIVGTRKNPNNDKIHIRQPPHNNISDYLFTYVNMNEKSCYFTLSKKVDDKKADVLWEPNY IHFNDAMKKVSKIIINEIVNINDFNVNNFTSIPIIIDYIMPCALCKKKIHKHHHQLTLGNGILKIFKAGNPHSCKVKAIA LEGNKLFTISQLIIDSNVIHLTERGDHVVWIKNSWKFNTDEPLITKLILNMKDQLPSEYIPDILCPRKRKVIENNLKDML VDTIETDTYPFMLPFKNGVLDICSGKFYKGAESKKFICTVSTGFNLDIEQYLNEDSQEMKDLNNIINDIQPLTEENKENR ELYERTLSSCLCGSTKQCLTFFFGETATGKSTTKKLLQSSIGELFIETGQTILTDIIDKGPNPFISNMHLKRSVFCSELP DFSCSGSKKIKADNIKKLTEPCIVGRPCFSNRIHNKNHASIIIDTNYKPVFDKVDNALMRRIALVKFRTHFSQYSNSDSV KNNAAYDDVKPLDENLDMKIQKNYFRYAFLNLLVKWYQKYHIPTMRLFPTPEAIPDFVFQLRVGSLLIPSSSTHLKFMSS LSKIGYVLENDLMVLPLQLFQQKISKHFNIKVYGNDIESFITKHKKFANVSEEYLEYIFIEDIISK
>lcl|l2_Invir15078896 | ref | NP_149647.1 | 184R [Invertebrate iridescent virus 6]
MTDVFKVLTPAKNINGEHTHVSMGDTKGTWYLSLNKSQEFYNVYGLALKNGQKLSLAEKPGEYVPLLVDIDLKKEVNGYP NYGSNDFYNDEDIINVVKIFQNAVSENVNRHAKKLTNKNLRCVVLEKDIFIERINESEDKYIVKKGIHLHFPHLFLPKKD IKNSFMPVVKTMIDQENVFQDFINSMDNQIMPSSLIDDISSKYWLMYGSSKEGLNKPYKISKILDHNQQEISISKCFKSE TCIDGSPITDTNVEFELPMLLSINPKPSIISNKLFYFKEAPVKLCDALLPVVNNNREKEGRMSSREIEKMKKLTSFLSVS RADDYNQWWTVGITLFNIGTGRDCEEEALEAWKMFSSQSTKYDESRCDLEWAEMKKKNRPLNARTMGSLIFMAKSDNPVA LEKYLLAEQMNIENWTSHQNLDVESIKKLKVPVFDTEIAEMFVSQHEDEYLNGNLGWFKFNGTIWSSLESVGRHMRPSLV SLSRSYLNLIPALKYITKTLQNDDEGYEPSDSGFGFDDDDSASTSGGKTTAEITKLVNSKIKLINDLAKKCQNNGPQMSL MKVIEDMIGIDNLNDKMDQNKQLIAFTNGVYDLSLFTFRQGLPEDYITRQMTIPYDITLTMENPKVIKMLNFFKKIFPDE ELFEYFMLENCEMYIGGNRDKILQIWTGEGDNGKSVTNKIIENKFGKLSVKFPKGMVTGDPPKAGACFPELTRAQRGVRW AVVDEFAPDETVNAGVIKNLTGGIDNLYARDIQQKGKDVIDIDPFFKLIFICNTIPNIRNPDNATWNRIRVIPFESTFKD SIDDISLEEQKRDKIFLKDTSFCEKETIRELGEAFAWYLIQVFIKKEQARRDARLNGKSFKIKIPAKVNEATELYKAQGN AIADYFNDKFEISDDDNDTINIKLYYQDFLLWFSQT HSNKNVNIDKKKFMKLFVQHAKGDMNTFICTKLKLKETLEEFNL ENNEENGMPLF

DNA_Topoisom

>lcl|u1_Lumsk15150522 | ref | NP_150517.1 | LSDV083 putative NTPase [Lumpy skin disease virus NI-2490]
MASHLVNNEYIFVLKKIGVHTSHRESEDPRFVDIFTCEELENYILKNPSCTLFETLRDEEAYSVVRVFFDVDLDIVLDEI DYTAALEDFILNVTKFVSIFSSRECGTNQNIVLKCMRSNFSLTKSTDTSRTSFHIVFPDTYTNMDTLIYMKKPLLEFLRS SENPLIRSIDPAVYRRKATLRIVGTRKNPNNDKIHIRQPPHNNISDYLFTYVNMNEKSCYFTLSKKVDDKKADVLWEPNY IHFNDAMKKVSKIIINEIVNINDFNVNNFTSIPIIIDYIMPCALCKKKIHKHHHQLTLGNGILKIFKAGNPHSCKVKAIA LEGNKLFTISQLIIDSNVIHLTERGDHVVWIKNSWKFNTDEPLITKLILNMKDQLPSEYIPDILCPRKRKVIENNLKDML VDTIETDTYPFMLPFKNGVLDICSGKFYKGAESKKFICTVSTGFNLDIEQYLNEDSQEMKDLNNIINDIQPLTEENKENR ELYERTLSSCLCGSTKQCLTFFFGETATGKSTTKKLLQSSIGELFIETGQTILTDIIDKGPNPFISNMHLKRSVFCSELP DFSCSGSKKIKADNIKKLTEPCIVGRPCFSNRIHNKNHASIIIDTNYKPVFDKVDNALMRRIALVKFRTHFSQYSNSDSV KNNAAYDDVKPLDENLDMKIQKNYFRYAFLNLLVKWYQKYHIPTMRLFPTPEAIPDFVFQLRVGSLLIPSSSTHLKFMSS LSKIGYVLENDLMVLPLQLFQQKISKHFNIKVYGNDIESFITKHKKFANVSEEYLEYIFIEDIISK
>lcl|l2_Invir15078896 | ref | NP_149647.1 | 184R [Invertebrate iridescent virus 6]
MTDVFKVLTPAKNINGEHTHVSMGDTKGTWYLSLNKSQEFYNVYGLALKNGQKLSLAEKPGEYVPLLVDIDLKKEVNGYP NYGSNDFYNDEDIINVVKIFQNAVSENVNRHAKKLTNKNLRCVVLEKDIFIERINESEDKYIVKKGIHLHFPHLFLPKKD IKNSFMPVVKTMIDQENVFQDFINSMDNQIMPSSLIDDISSKYWLMYGSSKEGLNKPYKISKILDHNQQEISISKCFKSE TCIDGSPITDTNVEFELPMLLSINPKPSIISNKLFYFKEAPVKLCDALLPVVNNNREKEGRMSSREIEKMKKLTSFLSVS RADDYNQWWTVGITLFNIGTGRDCEEEALEAWKMFSSQSTKYDESRCDLEWAEMKKKNRPLNARTMGSLIFMAKSDNPVA LEKYLLAEQMNIENWTSHQNLDVESIKKLKVPVFDTEIAEMFVSQHEDEYLNGNLGWFKFNGTIWSSLESVGRHMRPSLV SLSRSYLNLIPALKYITKTLQNDDEGYEPSDSGFGFDDDDSASTSGGKTTAEITKLVNSKIKLINDLAKKCQNNGPQMSL MKVIEDMIGIDNLNDKMDQNKQLIAFTNGVYDLSLFTFRQGLPEDYITRQMTIPYDITLTMENPKVIKMLNFFKKIFPDE ELFEYFMLENCEMYIGGNRDKILQIWTGEGDNGKSVTNKIIENKFGKLSVKFPKGMVTGDPPKAGACFPELTRAQRGVRW AVVDEFAPDETVNAGVIKNLTGGIDNLYARDIQQKGKDVIDIDPFFKLIFICNTIPNIRNPDNATWNRIRVIPFESTFKD SIDDISLEEQKRDKIFLKDTSFCEKETIRELGEAFAWYLIQVFIKKEQARRDARLNGKSFKIKIPAKVNEATELYKAQGN AIADYFNDKFEISDDDNDTINIKLYYQDFLLWFSQT HSNKNVNIDKKKFMKLFVQHAKGDMNTFICTKLKLKETLEEFNL ENNEENGMPLF

DNA_topoisomI

>lcl|u1_Lumsk15150522 | ref | NP_150517.1 | LSDV083 putative NTPase [Lumpy skin disease virus NI-2490]
MASHLVNNEYIFVLKKIGVHTSHRESEDPRFVDIFTCEELENYILKNPSCTLFETLRDEEAYSVVRVFFDVDLDIVLDEI DYTAALEDFILNVTKFVSIFSSRECGTNQNIVLKCMRSNFSLTKSTDTSRTSFHIVFPDTYTNMDTLIYMKKPLLEFLRS SENPLIRSIDPAVYRRKATLRIVGTRKNPNNDKIHIRQPPHNNISDYLFTYVNMNEKSCYFTLSKKVDDKKADVLWEPNY IHFNDAMKKVSKIIINEIVNINDFNVNNFTSIPIIIDYIMPCALCKKKIHKHHHQLTLGNGILKIFKAGNPHSCKVKAIA LEGNKLFTISQLIIDSNVIHLTERGDHVVWIKNSWKFNTDEPLITKLILNMKDQLPSEYIPDILCPRKRKVIENNLKDML VDTIETDTYPFMLPFKNGVLDICSGKFYKGAESKKFICTVSTGFNLDIEQYLNEDSQEMKDLNNIINDIQPLTEENKENR ELYERTLSSCLCGSTKQCLTFFFGETATGKSTTKKLLQSSIGELFIETGQTILTDIIDKGPNPFISNMHLKRSVFCSELP DFSCSGSKKIKADNIKKLTEPCIVGRPCFSNRIHNKNHASIIIDTNYKPVFDKVDNALMRRIALVKFRTHFSQYSNSDSV KNNAAYDDVKPLDENLDMKIQKNYFRYAFLNLLVKWYQKYHIPTMRLFPTPEAIPDFVFQLRVGSLLIPSSSTHLKFMSS LSKIGYVLENDLMVLPLQLFQQKISKHFNIKVYGNDIESFITKHKKFANVSEEYLEYIFIEDIISK
>lcl|l2_Invir15078896 | ref | NP_149647.1 | 184R [Invertebrate iridescent virus 6]
MTDVFKVLTPAKNINGEHTHVSMGDTKGTWYLSLNKSQEFYNVYGLALKNGQKLSLAEKPGEYVPLLVDIDLKKEVNGYP NYGSNDFYNDEDIINVVKIFQNAVSENVNRHAKKLTNKNLRCVVLEKDIFIERINESEDKYIVKKGIHLHFPHLFLPKKD IKNSFMPVVKTMIDQENVFQDFINSMDNQIMPSSLIDDISSKYWLMYGSSKEGLNKPYKISKILDHNQQEISISKCFKSE TCIDGSPITDTNVEFELPMLLSINPKPSIISNKLFYFKEAPVKLCDALLPVVNNNREKEGRMSSREIEKMKKLTSFLSVS RADDYNQWWTVGITLFNIGTGRDCEEEALEAWKMFSSQSTKYDESRCDLEWAEMKKKNRPLNARTMGSLIFMAKSDNPVA LEKYLLAEQMNIENWTSHQNLDVESIKKLKVPVFDTEIAEMFVSQHEDEYLNGNLGWFKFNGTIWSSLESVGRHMRPSLV SLSRSYLNLIPALKYITKTLQNDDEGYEPSDSGFGFDDDDSASTSGGKTTAEITKLVNSKIKLINDLAKKCQNNGPQMSL MKVIEDMIGIDNLNDKMDQNKQLIAFTNGVYDLSLFTFRQGLPEDYITRQMTIPYDITLTMENPKVIKMLNFFKKIFPDE ELFEYFMLENCEMYIGGNRDKILQIWTGEGDNGKSVTNKIIENKFGKLSVKFPKGMVTGDPPKAGACFPELTRAQRGVRW AVVDEFAPDETVNAGVIKNLTGGIDNLYARDIQQKGKDVIDIDPFFKLIFICNTIPNIRNPDNATWNRIRVIPFESTFKD SIDDISLEEQKRDKIFLKDTSFCEKETIRELGEAFAWYLIQVFIKKEQARRDARLNGKSFKIKIPAKVNEATELYKAQGN AIADYFNDKFEISDDDNDTINIKLYYQDFLLWFSQT HSNKNVNIDKKKFMKLFVQHAKGDMNTFICTKLKLKETLEEFNL ENNEENGMPLF

DNA_topoisomII

>lcl|u1_Lumsk15150522 | ref | NP_150517.1 | LSDV083 putative NTPase [Lumpy skin disease virus NI-2490]
MASHLVNNEYIFVLKKIGVHTSHRESEDPRFVDIFTCEELENYILKNPSCTLFETLRDEEAYSVVRVFFDVDLDIVLDEI DYTAALEDFILNVTKFVSIFSSRECGTNQNIVLKCMRSNFSLTKSTDTSRTSFHIVFPDTYTNMDTLIYMKKPLLEFLRS SENPLIRSIDPAVYRRKATLRIVGTRKNPNNDKIHIRQPPHNNISDYLFTYVNMNEKSCYFTLSKKVDDKKADVLWEPNY IHFNDAMKKVSKIIINEIVNINDFNVNNFTSIPIIIDYIMPCALCKKKIHKHHHQLTLGNGILKIFKAGNPHSCKVKAIA LEGNKLFTISQLIIDSNVIHLTERGDHVVWIKNSWKFNTDEPLITKLILNMKDQLPSEYIPDILCPRKRKVIENNLKDML VDTIETDTYPFMLPFKNGVLDICSGKFYKGAESKKFICTVSTGFNLDIEQYLNEDSQEMKDLNNIINDIQPLTEENKENR ELYERTLSSCLCGSTKQCLTFFFGETATGKSTTKKLLQSSIGELFIETGQTILTDIIDKGPNPFISNMHLKRSVFCSELP DFSCSGSKKIKADNIKKLTEPCIVGRPCFSNRIHNKNHASIIIDTNYKPVFDKVDNALMRRIALVKFRTHFSQYSNSDSV KNNAAYDDVKPLDENLDMKIQKNYFRYAFLNLLVKWYQKYHIPTMRLFPTPEAIPDFVFQLRVGSLLIPSSSTHLKFMSS LSKIGYVLENDLMVLPLQLFQQKISKHFNIKVYGNDIESFITKHKKFANVSEEYLEYIFIEDIISK
>lcl|l2_Invir15078896 | ref | NP_149647.1 | 184R [Invertebrate iridescent virus 6]
MTDVFKVLTPAKNINGEHTHVSMGDTKGTWYLSLNKSQEFYNVYGLALKNGQKLSLAEKPGEYVPLLVDIDLKKEVNGYP NYGSNDFYNDEDIINVVKIFQNAVSENVNRHAKKLTNKNLRCVVLEKDIFIERINESEDKYIVKKGIHLHFPHLFLPKKD IKNSFMPVVKTMIDQENVFQDFINSMDNQIMPSSLIDDISSKYWLMYGSSKEGLNKPYKISKILDHNQQEISISKCFKSE TCIDGSPITDTNVEFELPMLLSINPKPSIISNKLFYFKEAPVKLCDALLPVVNNNREKEGRMSSREIEKMKKLTSFLSVS RADDYNQWWTVGITLFNIGTGRDCEEEALEAWKMFSSQSTKYDESRCDLEWAEMKKKNRPLNARTMGSLIFMAKSDNPVA LEKYLLAEQMNIENWTSHQNLDVESIKKLKVPVFDTEIAEMFVSQHEDEYLNGNLGWFKFNGTIWSSLESVGRHMRPSLV SLSRSYLNLIPALKYITKTLQNDDEGYEPSDSGFGFDDDDSASTSGGKTTAEITKLVNSKIKLINDLAKKCQNNGPQMSL MKVIEDMIGIDNLNDKMDQNKQLIAFTNGVYDLSLFTFRQGLPEDYITRQMTIPYDITLTMENPKVIKMLNFFKKIFPDE ELFEYFMLENCEMYIGGNRDKILQIWTGEGDNGKSVTNKIIENKFGKLSVKFPKGMVTGDPPKAGACFPELTRAQRGVRW AVVDEFAPDETVNAGVIKNLTGGIDNLYARDIQQKGKDVIDIDPFFKLIFICNTIPNIRNPDNATWNRIRVIPFESTFKD SIDDISLEEQKRDKIFLKDTSFCEKETIRELGEAFAWYLIQVFIKKEQARRDARLNGKSFKIKIPAKVNEATELYKAQGN AIADYFNDKFEISDDDNDTINIKLYYQDFLLWFSQT HSNKNVNIDKKKFMKLFVQHAKGDMNTFICTKLKLKETLEEFNL ENNEENGMPLF

Endonuclease

>lcl|u1_Lumsk15150522 | ref | NP_150517.1 | LSDV083 putative NTPase [Lumpy skin disease virus NI-2490]
MASHLVNNEYIFVLKKIGVHTSHRESEDPRFVDIFTCEELENYILKNPSCTLFETLRDEEAYSVVRVFFDVDLDIVLDEI DYTAALEDFILNVTKFVSIFSSRECGTNQNIVLKCMRSNFSLTKSTDTSRTSFHIVFPDTYTNMDTLIYMKKPLLEFLRS SENPLIRSIDPAVYRRKATLRIVGTRKNPNNDKIHIRQPPHNNISDYLFTYVNMNEKSCYFTLSKKVDDKKADVLWEPNY IHFNDAMKKVSKIIINEIVNINDFNVNNFTSIPIIIDYIMPCALCKKKIHKHHHQLTLGNGILKIFKAGNPHSCKVKAIA LEGNKLFTISQLIIDSNVIHLTERGDHVVWIKNSWKFNTDEPLITKLILNMKDQLPSEYIPDILCPRKRKVIENNLKDML VDTIETDTYPFMLPFKNGVLDICSGKFYKGAESKKFICTVSTGFNLDIEQYLNEDSQEMKDLNNIINDIQPLTEENKENR ELYERTLSSCLCGSTKQCLTFFFGETATGKSTTKKLLQSSIGELFIETGQTILTDIIDKGPNPFISNMHLKRSVFCSELP DFSCSGSKKIKADNIKKLTEPCIVGRPCFSNRIHNKNHASIIIDTNYKPVFDKVDNALMRRIALVKFRTHFSQYSNSDSV KNNAAYDDVKPLDENLDMKIQKNYFRYAFLNLLVKWYQKYHIPTMRLFPTPEAIPDFVFQLRVGSLLIPSSSTHLKFMSS LSKIGYVLENDLMVLPLQLFQQKISKHFNIKVYGNDIESFITKHKKFANVSEEYLEYIFIEDIISK
>lcl|l2_Invir15078896 | ref | NP_149647.1 | 184R [Invertebrate iridescent virus 6]
MTDVFKVLTPAKNINGEHTHVSMGDTKGTWYLSLNKSQEFYNVYGLALKNGQKLSLAEKPGEYVPLLVDIDLKKEVNGYP NYGSNDFYNDEDIINVVKIFQNAVSENVNRHAKKLTNKNLRCVVLEKDIFIERINESEDKYIVKKGIHLHFPHLFLPKKD IKNSFMPVVKTMIDQENVFQDFINSMDNQIMPSSLIDDISSKYWLMYGSSKEGLNKPYKISKILDHNQQEISISKCFKSE TCIDGSPITDTNVEFELPMLLSINPKPSIISNKLFYFKEAPVKLCDALLPVVNNNREKEGRMSSREIEKMKKLTSFLSVS RADDYNQWWTVGITLFNIGTGRDCEEEALEAWKMFSSQSTKYDESRCDLEWAEMKKKNRPLNARTMGSLIFMAKSDNPVA LEKYLLAEQMNIENWTSHQNLDVESIKKLKVPVFDTEIAEMFVSQHEDEYLNGNLGWFKFNGTIWSSLESVGRHMRPSLV SLSRSYLNLIPALKYITKTLQNDDEGYEPSDSGFGFDDDDSASTSGGKTTAEITKLVNSKIKLINDLAKKCQNNGPQMSL MKVIEDMIGIDNLNDKMDQNKQLIAFTNGVYDLSLFTFRQGLPEDYITRQMTIPYDITLTMENPKVIKMLNFFKKIFPDE ELFEYFMLENCEMYIGGNRDKILQIWTGEGDNGKSVTNKIIENKFGKLSVKFPKGMVTGDPPKAGACFPELTRAQRGVRW AVVDEFAPDETVNAGVIKNLTGGIDNLYARDIQQKGKDVIDIDPFFKLIFICNTIPNIRNPDNATWNRIRVIPFESTFKD SIDDISLEEQKRDKIFLKDTSFCEKETIRELGEAFAWYLIQVFIKKEQARRDARLNGKSFKIKIPAKVNEATELYKAQGN AIADYFNDKFEISDDDNDTINIKLYYQDFLLWFSQT HSNKNVNIDKKKFMKLFVQHAKGDMNTFICTKLKLKETLEEFNL ENNEENGMPLF

AP_endonucl_2

>lcl|u1_Lumsk15150522 | ref | NP_150517.1 | LSDV083 putative NTPase [Lumpy skin disease virus NI-2490]
MASHLVNNEYIFVLKKIGVHTSHRESEDPRFVDIFTCEELENYILKNPSCTLFETLRDEEAYSVVRVFFDVDLDIVLDEI DYTAALEDFILNVTKFVSIFSSRECGTNQNIVLKCMRSNFSLTKSTDTSRTSFHIVFPDTYTNMDTLIYMKKPLLEFLRS SENPLIRSIDPAVYRRKATLRIVGTRKNPNNDKIHIRQPPHNNISDYLFTYVNMNEKSCYFTLSKKVDDKKADVLWEPNY IHFNDAMKKVSKIIINEIVNINDFNVNNFTSIPIIIDYIMPCALCKKKIHKHHHQLTLGNGILKIFKAGNPHSCKVKAIA LEGNKLFTISQLIIDSNVIHLTERGDHVVWIKNSWKFNTDEPLITKLILNMKDQLPSEYIPDILCPRKRKVIENNLKDML VDTIETDTYPFMLPFKNGVLDICSGKFYKGAESKKFICTVSTGFNLDIEQYLNEDSQEMKDLNNIINDIQPLTEENKENR ELYERTLSSCLCGSTKQCLTFFFGETATGKSTTKKLLQSSIGELFIETGQTILTDIIDKGPNPFISNMHLKRSVFCSELP DFSCSGSKKIKADNIKKLTEPCIVGRPCFSNRIHNKNHASIIIDTNYKPVFDKVDNALMRRIALVKFRTHFSQYSNSDSV KNNAAYDDVKPLDENLDMKIQKNYFRYAFLNLLVKWYQKYHIPTMRLFPTPEAIPDFVFQLRVGSLLIPSSSTHLKFMSS LSKIGYVLENDLMVLPLQLFQQKISKHFNIKVYGNDIESFITKHKKFANVSEEYLEYIFIEDIISK
>lcl|l2_Invir15078896 | ref | NP_149647.1 | 184R [Invertebrate iridescent virus 6]
MTDVFKVLTPAKNINGEHTHVSMGDTKGTWYLSLNKSQEFYNVYGLALKNGQKLSLAEKPGEYVPLLVDIDLKKEVNGYP NYGSNDFYNDEDIINVVKIFQNAVSENVNRHAKKLTNKNLRCVVLEKDIFIERINESEDKYIVKKGIHLHFPHLFLPKKD IKNSFMPVVKTMIDQENVFQDFINSMDNQIMPSSLIDDISSKYWLMYGSSKEGLNKPYKISKILDHNQQEISISKCFKSE TCIDGSPITDTNVEFELPMLLSINPKPSIISNKLFYFKEAPVKLCDALLPVVNNNREKEGRMSSREIEKMKKLTSFLSVS RADDYNQWWTVGITLFNIGTGRDCEEEALEAWKMFSSQSTKYDESRCDLEWAEMKKKNRPLNARTMGSLIFMAKSDNPVA LEKYLLAEQMNIENWTSHQNLDVESIKKLKVPVFDTEIAEMFVSQHEDEYLNGNLGWFKFNGTIWSSLESVGRHMRPSLV SLSRSYLNLIPALKYITKTLQNDDEGYEPSDSGFGFDDDDSASTSGGKTTAEITKLVNSKIKLINDLAKKCQNNGPQMSL MKVIEDMIGIDNLNDKMDQNKQLIAFTNGVYDLSLFTFRQGLPEDYITRQMTIPYDITLTMENPKVIKMLNFFKKIFPDE ELFEYFMLENCEMYIGGNRDKILQIWTGEGDNGKSVTNKIIENKFGKLSVKFPKGMVTGDPPKAGACFPELTRAQRGVRW AVVDEFAPDETVNAGVIKNLTGGIDNLYARDIQQKGKDVIDIDPFFKLIFICNTIPNIRNPDNATWNRIRVIPFESTFKD SIDDISLEEQKRDKIFLKDTSFCEKETIRELGEAFAWYLIQVFIKKEQARRDARLNGKSFKIKIPAKVNEATELYKAQGN AIADYFNDKFEISDDDNDTINIKLYYQDFLLWFSQT HSNKNVNIDKKKFMKLFVQHAKGDMNTFICTKLKLKETLEEFNL ENNEENGMPLF

HJR_endonuclease

>lcl|u1_Lumsk15150522 | ref | NP_150517.1 | LSDV083 putative NTPase [Lumpy skin disease virus NI-2490]
MASHLVNNEYIFVLKKIGVHTSHRESEDPRFVDIFTCEELENYILKNPSCTLFETLRDEEAYSVVRVFFDVDLDIVLDEI DYTAALEDFILNVTKFVSIFSSRECGTNQNIVLKCMRSNFSLTKSTDTSRTSFHIVFPDTYTNMDTLIYMKKPLLEFLRS SENPLIRSIDPAVYRRKATLRIVGTRKNPNNDKIHIRQPPHNNISDYLFTYVNMNEKSCYFTLSKKVDDKKADVLWEPNY IHFNDAMKKVSKIIINEIVNINDFNVNNFTSIPIIIDYIMPCALCKKKIHKHHHQLTLGNGILKIFKAGNPHSCKVKAIA LEGNKLFTISQLIIDSNVIHLTERGDHVVWIKNSWKFNTDEPLITKLILNMKDQLPSEYIPDILCPRKRKVIENNLKDML VDTIETDTYPFMLPFKNGVLDICSGKFYKGAESKKFICTVSTGFNLDIEQYLNEDSQEMKDLNNIINDIQPLTEENKENR ELYERTLSSCLCGSTKQCLTFFFGETATGKSTTKKLLQSSIGELFIETGQTILTDIIDKGPNPFISNMHLKRSVFCSELP DFSCSGSKKIKADNIKKLTEPCIVGRPCFSNRIHNKNHASIIIDTNYKPVFDKVDNALMRRIALVKFRTHFSQYSNSDSV KNNAAYDDVKPLDENLDMKIQKNYFRYAFLNLLVKWYQKYHIPTMRLFPTPEAIPDFVFQLRVGSLLIPSSSTHLKFMSS LSKIGYVLENDLMVLPLQLFQQKISKHFNIKVYGNDIESFITKHKKFANVSEEYLEYIFIEDIISK
>lcl|l2_Invir15078896 | ref | NP_149647.1 | 184R [Invertebrate iridescent virus 6]
MTDVFKVLTPAKNINGEHTHVSMGDTKGTWYLSLNKSQEFYNVYGLALKNGQKLSLAEKPGEYVPLLVDIDLKKEVNGYP NYGSNDFYNDEDIINVVKIFQNAVSENVNRHAKKLTNKNLRCVVLEKDIFIERINESEDKYIVKKGIHLHFPHLFLPKKD IKNSFMPVVKTMIDQENVFQDFINSMDNQIMPSSLIDDISSKYWLMYGSSKEGLNKPYKISKILDHNQQEISISKCFKSE TCIDGSPITDTNVEFELPMLLSINPKPSIISNKLFYFKEAPVKLCDALLPVVNNNREKEGRMSSREIEKMKKLTSFLSVS RADDYNQWWTVGITLFNIGTGRDCEEEALEAWKMFSSQSTKYDESRCDLEWAEMKKKNRPLNARTMGSLIFMAKSDNPVA LEKYLLAEQMNIENWTSHQNLDVESIKKLKVPVFDTEIAEMFVSQHEDEYLNGNLGWFKFNGTIWSSLESVGRHMRPSLV SLSRSYLNLIPALKYITKTLQNDDEGYEPSDSGFGFDDDDSASTSGGKTTAEITKLVNSKIKLINDLAKKCQNNGPQMSL MKVIEDMIGIDNLNDKMDQNKQLIAFTNGVYDLSLFTFRQGLPEDYITRQMTIPYDITLTMENPKVIKMLNFFKKIFPDE ELFEYFMLENCEMYIGGNRDKILQIWTGEGDNGKSVTNKIIENKFGKLSVKFPKGMVTGDPPKAGACFPELTRAQRGVRW AVVDEFAPDETVNAGVIKNLTGGIDNLYARDIQQKGKDVIDIDPFFKLIFICNTIPNIRNPDNATWNRIRVIPFESTFKD SIDDISLEEQKRDKIFLKDTSFCEKETIRELGEAFAWYLIQVFIKKEQARRDARLNGKSFKIKIPAKVNEATELYKAQGN AIADYFNDKFEISDDDNDTINIKLYYQDFLLWFSQT HSNKNVNIDKKKFMKLFVQHAKGDMNTFICTKLKLKETLEEFNL ENNEENGMPLF

HJR_endonuclease_A

>lcl|u1_Lumsk15150522 | ref | NP_150517.1 | LSDV083 putative NTPase [Lumpy skin disease virus NI-2490]
MASHLVNNEYIFVLKKIGVHTSHRESEDPRFVDIFTCEELENYILKNPSCTLFETLRDEEAYSVVRVFFDVDLDIVLDEI DYTAALEDFILNVTKFVSIFSSRECGTNQNIVLKCMRSNFSLTKSTDTSRTSFHIVFPDTYTNMDTLIYMKKPLLEFLRS SENPLIRSIDPAVYRRKATLRIVGTRKNPNNDKIHIRQPPHNNISDYLFTYVNMNEKSCYFTLSKKVDDKKADVLWEPNY IHFNDAMKKVSKIIINEIVNINDFNVNNFTSIPIIIDYIMPCALCKKKIHKHHHQLTLGNGILKIFKAGNPHSCKVKAIA LEGNKLFTISQLIIDSNVIHLTERGDHVVWIKNSWKFNTDEPLITKLILNMKDQLPSEYIPDILCPRKRKVIENNLKDML VDTIETDTYPFMLPFKNGVLDICSGKFYKGAESKKFICTVSTGFNLDIEQYLNEDSQEMKDLNNIINDIQPLTEENKENR ELYERTLSSCLCGSTKQCLTFFFGETATGKSTTKKLLQSSIGELFIETGQTILTDIIDKGPNPFISNMHLKRSVFCSELP DFSCSGSKKIKADNIKKLTEPCIVGRPCFSNRIHNKNHASIIIDTNYKPVFDKVDNALMRRIALVKFRTHFSQYSNSDSV KNNAAYDDVKPLDENLDMKIQKNYFRYAFLNLLVKWYQKYHIPTMRLFPTPEAIPDFVFQLRVGSLLIPSSSTHLKFMSS LSKIGYVLENDLMVLPLQLFQQKISKHFNIKVYGNDIESFITKHKKFANVSEEYLEYIFIEDIISK
>lcl|l2_Invir15078896 | ref | NP_149647.1 | 184R [Invertebrate iridescent virus 6]
MTDVFKVLTPAKNINGEHTHVSMGDTKGTWYLSLNKSQEFYNVYGLALKNGQKLSLAEKPGEYVPLLVDIDLKKEVNGYP NYGSNDFYNDEDIINVVKIFQNAVSENVNRHAKKLTNKNLRCVVLEKDIFIERINESEDKYIVKKGIHLHFPHLFLPKKD IKNSFMPVVKTMIDQENVFQDFINSMDNQIMPSSLIDDISSKYWLMYGSSKEGLNKPYKISKILDHNQQEISISKCFKSE TCIDGSPITDTNVEFELPMLLSINPKPSIISNKLFYFKEAPVKLCDALLPVVNNNREKEGRMSSREIEKMKKLTSFLSVS RADDYNQWWTVGITLFNIGTGRDCEEEALEAWKMFSSQSTKYDESRCDLEWAEMKKKNRPLNARTMGSLIFMAKSDNPVA LEKYLLAEQMNIENWTSHQNLDVESIKKLKVPVFDTEIAEMFVSQHEDEYLNGNLGWFKFNGTIWSSLESVGRHMRPSLV SLSRSYLNLIPALKYITKTLQNDDEGYEPSDSGFGFDDDDSASTSGGKTTAEITKLVNSKIKLINDLAKKCQNNGPQMSL MKVIEDMIGIDNLNDKMDQNKQLIAFTNGVYDLSLFTFRQGLPEDYITRQMTIPYDITLTMENPKVIKMLNFFKKIFPDE ELFEYFMLENCEMYIGGNRDKILQIWTGEGDNGKSVTNKIIENKFGKLSVKFPKGMVTGDPPKAGACFPELTRAQRGVRW AVVDEFAPDETVNAGVIKNLTGGIDNLYARDIQQKGKDVIDIDPFFKLIFICNTIPNIRNPDNATWNRIRVIPFESTFKD SIDDISLEEQKRDKIFLKDTSFCEKETIRELGEAFAWYLIQVFIKKEQARRDARLNGKSFKIKIPAKVNEATELYKAQGN AIADYFNDKFEISDDDNDTINIKLYYQDFLLWFSQT HSNKNVNIDKKKFMKLFVQHAKGDMNTFICTKLKLKETLEEFNL ENNEENGMPLF

HJR_endonuclease_B

>lcl|u1_Lumsk15150522 | ref | NP_150517.1 | LSDV083 putative NTPase [Lumpy skin disease virus NI-2490]
MASHLVNNEYIFVLKKIGVHTSHRESEDPRFVDIFTCEELENYILKNPSCTLFETLRDEEAYSVVRVFFDVDLDIVLDEI DYTAALEDFILNVTKFVSIFSSRECGTNQNIVLKCMRSNFSLTKSTDTSRTSFHIVFPDTYTNMDTLIYMKKPLLEFLRS SENPLIRSIDPAVYRRKATLRIVGTRKNPNNDKIHIRQPPHNNISDYLFTYVNMNEKSCYFTLSKKVDDKKADVLWEPNY IHFNDAMKKVSKIIINEIVNINDFNVNNFTSIPIIIDYIMPCALCKKKIHKHHHQLTLGNGILKIFKAGNPHSCKVKAIA LEGNKLFTISQLIIDSNVIHLTERGDHVVWIKNSWKFNTDEPLITKLILNMKDQLPSEYIPDILCPRKRKVIENNLKDML VDTIETDTYPFMLPFKNGVLDICSGKFYKGAESKKFICTVSTGFNLDIEQYLNEDSQEMKDLNNIINDIQPLTEENKENR ELYERTLSSCLCGSTKQCLTFFFGETATGKSTTKKLLQSSIGELFIETGQTILTDIIDKGPNPFISNMHLKRSVFCSELP DFSCSGSKKIKADNIKKLTEPCIVGRPCFSNRIHNKNHASIIIDTNYKPVFDKVDNALMRRIALVKFRTHFSQYSNSDSV KNNAAYDDVKPLDENLDMKIQKNYFRYAFLNLLVKWYQKYHIPTMRLFPTPEAIPDFVFQLRVGSLLIPSSSTHLKFMSS LSKIGYVLENDLMVLPLQLFQQKISKHFNIKVYGNDIESFITKHKKFANVSEEYLEYIFIEDIISK
>lcl|l2_Invir15078896 | ref | NP_149647.1 | 184R [Invertebrate iridescent virus 6]
MTDVFKVLTPAKNINGEHTHVSMGDTKGTWYLSLNKSQEFYNVYGLALKNGQKLSLAEKPGEYVPLLVDIDLKKEVNGYP NYGSNDFYNDEDIINVVKIFQNAVSENVNRHAKKLTNKNLRCVVLEKDIFIERINESEDKYIVKKGIHLHFPHLFLPKKD IKNSFMPVVKTMIDQENVFQDFINSMDNQIMPSSLIDDISSKYWLMYGSSKEGLNKPYKISKILDHNQQEISISKCFKSE TCIDGSPITDTNVEFELPMLLSINPKPSIISNKLFYFKEAPVKLCDALLPVVNNNREKEGRMSSREIEKMKKLTSFLSVS RADDYNQWWTVGITLFNIGTGRDCEEEALEAWKMFSSQSTKYDESRCDLEWAEMKKKNRPLNARTMGSLIFMAKSDNPVA LEKYLLAEQMNIENWTSHQNLDVESIKKLKVPVFDTEIAEMFVSQHEDEYLNGNLGWFKFNGTIWSSLESVGRHMRPSLV SLSRSYLNLIPALKYITKTLQNDDEGYEPSDSGFGFDDDDSASTSGGKTTAEITKLVNSKIKLINDLAKKCQNNGPQMSL MKVIEDMIGIDNLNDKMDQNKQLIAFTNGVYDLSLFTFRQGLPEDYITRQMTIPYDITLTMENPKVIKMLNFFKKIFPDE ELFEYFMLENCEMYIGGNRDKILQIWTGEGDNGKSVTNKIIENKFGKLSVKFPKGMVTGDPPKAGACFPELTRAQRGVRW AVVDEFAPDETVNAGVIKNLTGGIDNLYARDIQQKGKDVIDIDPFFKLIFICNTIPNIRNPDNATWNRIRVIPFESTFKD SIDDISLEEQKRDKIFLKDTSFCEKETIRELGEAFAWYLIQVFIKKEQARRDARLNGKSFKIKIPAKVNEATELYKAQGN AIADYFNDKFEISDDDNDTINIKLYYQDFLLWFSQT HSNKNVNIDKKKFMKLFVQHAKGDMNTFICTKLKLKETLEEFNL ENNEENGMPLF

HNH_endonuclease

>lcl|u1_Lumsk15150522 | ref | NP_150517.1 | LSDV083 putative NTPase [Lumpy skin disease virus NI-2490]
MASHLVNNEYIFVLKKIGVHTSHRESEDPRFVDIFTCEELENYILKNPSCTLFETLRDEEAYSVVRVFFDVDLDIVLDEI DYTAALEDFILNVTKFVSIFSSRECGTNQNIVLKCMRSNFSLTKSTDTSRTSFHIVFPDTYTNMDTLIYMKKPLLEFLRS SENPLIRSIDPAVYRRKATLRIVGTRKNPNNDKIHIRQPPHNNISDYLFTYVNMNEKSCYFTLSKKVDDKKADVLWEPNY IHFNDAMKKVSKIIINEIVNINDFNVNNFTSIPIIIDYIMPCALCKKKIHKHHHQLTLGNGILKIFKAGNPHSCKVKAIA LEGNKLFTISQLIIDSNVIHLTERGDHVVWIKNSWKFNTDEPLITKLILNMKDQLPSEYIPDILCPRKRKVIENNLKDML VDTIETDTYPFMLPFKNGVLDICSGKFYKGAESKKFICTVSTGFNLDIEQYLNEDSQEMKDLNNIINDIQPLTEENKENR ELYERTLSSCLCGSTKQCLTFFFGETATGKSTTKKLLQSSIGELFIETGQTILTDIIDKGPNPFISNMHLKRSVFCSELP DFSCSGSKKIKADNIKKLTEPCIVGRPCFSNRIHNKNHASIIIDTNYKPVFDKVDNALMRRIALVKFRTHFSQYSNSDSV KNNAAYDDVKPLDENLDMKIQKNYFRYAFLNLLVKWYQKYHIPTMRLFPTPEAIPDFVFQLRVGSLLIPSSSTHLKFMSS LSKIGYVLENDLMVLPLQLFQQKISKHFNIKVYGNDIESFITKHKKFANVSEEYLEYIFIEDIISK
>lcl|l2_Invir15078896 | ref | NP_149647.1 | 184R [Invertebrate iridescent virus 6]
MTDVFKVLTPAKNINGEHTHVSMGDTKGTWYLSLNKSQEFYNVYGLALKNGQKLSLAEKPGEYVPLLVDIDLKKEVNGYP NYGSNDFYNDEDIINVVKIFQNAVSENVNRHAKKLTNKNLRCVVLEKDIFIERINESEDKYIVKKGIHLHFPHLFLPKKD IKNSFMPVVKTMIDQENVFQDFINSMDNQIMPSSLIDDISSKYWLMYGSSKEGLNKPYKISKILDHNQQEISISKCFKSE TCIDGSPITDTNVEFELPMLLSINPKPSIISNKLFYFKEAPVKLCDALLPVVNNNREKEGRMSSREIEKMKKLTSFLSVS RADDYNQWWTVGITLFNIGTGRDCEEEALEAWKMFSSQSTKYDESRCDLEWAEMKKKNRPLNARTMGSLIFMAKSDNPVA LEKYLLAEQMNIENWTSHQNLDVESIKKLKVPVFDTEIAEMFVSQHEDEYLNGNLGWFKFNGTIWSSLESVGRHMRPSLV SLSRSYLNLIPALKYITKTLQNDDEGYEPSDSGFGFDDDDSASTSGGKTTAEITKLVNSKIKLINDLAKKCQNNGPQMSL MKVIEDMIGIDNLNDKMDQNKQLIAFTNGVYDLSLFTFRQGLPEDYITRQMTIPYDITLTMENPKVIKMLNFFKKIFPDE ELFEYFMLENCEMYIGGNRDKILQIWTGEGDNGKSVTNKIIENKFGKLSVKFPKGMVTGDPPKAGACFPELTRAQRGVRW AVVDEFAPDETVNAGVIKNLTGGIDNLYARDIQQKGKDVIDIDPFFKLIFICNTIPNIRNPDNATWNRIRVIPFESTFKD SIDDISLEEQKRDKIFLKDTSFCEKETIRELGEAFAWYLIQVFIKKEQARRDARLNGKSFKIKIPAKVNEATELYKAQGN AIADYFNDKFEISDDDNDTINIKLYYQDFLLWFSQT HSNKNVNIDKKKFMKLFVQHAKGDMNTFICTKLKLKETLEEFNL ENNEENGMPLF