Alignments

Explanatory text

Alignment for Row 3

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-
>lcl|q1_Acatu155371013 | ref | YP_001426547.1 | hypothetical protein ATCV1_Z066R [Acanthocystis turfacea Chlorella virus 1]
----MVTNTPKKNMKSSKEEEQAAELSIITGIKRLGV-DDCLERLENMCQSW---RLYET TATFESQIISMFGALDVNFDDDLIDAVSTDRGYFGLREVNDKIKKSELEAMTLFHRL-RE LNLLPTK-----NDDNETHHDSLKKITKILEMI---FYTKKVVLSSYQAKIAVHQLAAEE GVVDLNPDIDSVLGSWNLRFRMVGDDVSQFQELLLYLLDCAMENGYRKQDGFLYEPI-VI DGRNMHSYRQVYEIKEFVYSRLRKEISFEHWSKGTQNMKNISSA--VEYLT-NCHDTQLP VLHKSRGTYAFTNGVYIASE---DR------FHCF-ETSE-TPLSDSVV----------- ---------AC-KFFEMKFDNTQY-----------DDWFDIPTP-----HLDSVMNHQQW PKEVQMWLLCLIGRVLYRTNEIDSWQVCPFFVGLAGTGKSLLVLKVIKQFFETVDVGILS NNIERKFGISAFYDKMLVCAPEIRNDLAIEQAEFQSIVSGEEISVAVKFQKAFLQEWDVP IVLAGNEVPGWADAGGSIQRRLVVFEFKQPVKEGDMK---LSEKLYREMPNIIRRRT--- -----------------------------------RRTGTLRTCM--------------L TRTSGRCSRSTSSTPARQSRARRTLS-------------RASYHRSTLPWARTAWC---- -------LSRTSRAHSRTTPLPTLCT

Alignment for Row 4

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-
>lcl|q1_Acatu155371013 | ref | YP_001426547.1 | hypothetical protein ATCV1_Z066R [Acanthocystis turfacea Chlorella virus 1]
----MVTNTPKKNMKSSKEEEQAAELSIITGIKRLGV-DDCLERLENMCQSW---RLYET TATFESQIISMFGALDVNFDDDLIDAVSTDRGYFGLREVNDKIKKSELEAMTLFHRL-RE LNLLPTK-----NDDNETHHDSLKKITKILEMI---FYTKKVVLSSYQAKIAVHQLAAEE GVVDLNPDIDSVLGSWNLRFRMVGDDVSQFQELLLYLLDCAMENGYRKQDGFLYEPI-VI DGRNMHSYRQVYEIKEFVYSRLRKEISFEHWSKGTQNMKNISSA--VEYLT-NCHDTQLP VLHKSRGTYAFTNGVYIASE---DR------FHCF-ETSE-TPLSDSVV----------- ---------AC-KFFEMKFDNTQY-----------DDWFDIPTP-----HLDSVMNHQQW PKEVQMWLLCLIGRVLYRTNEIDSWQVCPFFVGLAGTGKSLLVLKVIKQFFETVDVGILS NNIERKFGISAFYDKMLVCAPEIRNDLAIEQAEFQSIVSGEEISVAVKFQKAFLQEWDVP IVLAGNEVPGWADAGGSIQRRLVVFEFKQPVKEGDMK---LSEKLYREMPNIIRRRT--- -----------------------------------RRTGTLRTCM--------------L TRTSGRCSRSTSSTPARQSRARRTLS-------------RASYHRSTLPWARTAWC---- -------LSRTSRAHSRTTPLPTLCT

Alignment for Row 5

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-
>lcl|q1_Acatu155371013 | ref | YP_001426547.1 | hypothetical protein ATCV1_Z066R [Acanthocystis turfacea Chlorella virus 1]
----MVTNTPKKNMKSSKEEEQAAELSIITGIKRLGV-DDCLERLENMCQSW---RLYET TATFESQIISMFGALDVNFDDDLIDAVSTDRGYFGLREVNDKIKKSELEAMTLFHRL-RE LNLLPTK-----NDDNETHHDSLKKITKILEMI---FYTKKVVLSSYQAKIAVHQLAAEE GVVDLNPDIDSVLGSWNLRFRMVGDDVSQFQELLLYLLDCAMENGYRKQDGFLYEPI-VI DGRNMHSYRQVYEIKEFVYSRLRKEISFEHWSKGTQNMKNISSA--VEYLT-NCHDTQLP VLHKSRGTYAFTNGVYIASE---DR------FHCF-ETSE-TPLSDSVV----------- ---------AC-KFFEMKFDNTQY-----------DDWFDIPTP-----HLDSVMNHQQW PKEVQMWLLCLIGRVLYRTNEIDSWQVCPFFVGLAGTGKSLLVLKVIKQFFETVDVGILS NNIERKFGISAFYDKMLVCAPEIRNDLAIEQAEFQSIVSGEEISVAVKFQKAFLQEWDVP IVLAGNEVPGWADAGGSIQRRLVVFEFKQPVKEGDMK---LSEKLYREMPNIIRRRT--- -----------------------------------RRTGTLRTCM--------------L TRTSGRCSRSTSSTPARQSRARRTLS-------------RASYHRSTLPWARTAWC---- -------LSRTSRAHSRTTPLPTLCT

Alignment for Row 6

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-
>lcl|q1_Acatu155371013 | ref | YP_001426547.1 | hypothetical protein ATCV1_Z066R [Acanthocystis turfacea Chlorella virus 1]
----MVTNTPKKNMKSSKEEEQAAELSIITGIKRLGV-DDCLERLENMCQSW---RLYET TATFESQIISMFGALDVNFDDDLIDAVSTDRGYFGLREVNDKIKKSELEAMTLFHRL-RE LNLLPTK-----NDDNETHHDSLKKITKILEMI---FYTKKVVLSSYQAKIAVHQLAAEE GVVDLNPDIDSVLGSWNLRFRMVGDDVSQFQELLLYLLDCAMENGYRKQDGFLYEPI-VI DGRNMHSYRQVYEIKEFVYSRLRKEISFEHWSKGTQNMKNISSA--VEYLT-NCHDTQLP VLHKSRGTYAFTNGVYIASE---DR------FHCF-ETSE-TPLSDSVV----------- ---------AC-KFFEMKFDNTQY-----------DDWFDIPTP-----HLDSVMNHQQW PKEVQMWLLCLIGRVLYRTNEIDSWQVCPFFVGLAGTGKSLLVLKVIKQFFETVDVGILS NNIERKFGISAFYDKMLVCAPEIRNDLAIEQAEFQSIVSGEEISVAVKFQKAFLQEWDVP IVLAGNEVPGWADAGGSIQRRLVVFEFKQPVKEGDMK---LSEKLYREMPNIIRRRT--- -----------------------------------RRTGTLRTCM--------------L TRTSGRCSRSTSSTPARQSRARRTLS-------------RASYHRSTLPWARTAWC---- -------LSRTSRAHSRTTPLPTLCT

Alignment for Row 7

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-
>lcl|q1_Acatu155371013 | ref | YP_001426547.1 | hypothetical protein ATCV1_Z066R [Acanthocystis turfacea Chlorella virus 1]
----MVTNTPKKNMKSSKEEEQAAELSIITGIKRLGV-DDCLERLENMCQSW---RLYET TATFESQIISMFGALDVNFDDDLIDAVSTDRGYFGLREVNDKIKKSELEAMTLFHRL-RE LNLLPTK-----NDDNETHHDSLKKITKILEMI---FYTKKVVLSSYQAKIAVHQLAAEE GVVDLNPDIDSVLGSWNLRFRMVGDDVSQFQELLLYLLDCAMENGYRKQDGFLYEPI-VI DGRNMHSYRQVYEIKEFVYSRLRKEISFEHWSKGTQNMKNISSA--VEYLT-NCHDTQLP VLHKSRGTYAFTNGVYIASE---DR------FHCF-ETSE-TPLSDSVV----------- ---------AC-KFFEMKFDNTQY-----------DDWFDIPTP-----HLDSVMNHQQW PKEVQMWLLCLIGRVLYRTNEIDSWQVCPFFVGLAGTGKSLLVLKVIKQFFETVDVGILS NNIERKFGISAFYDKMLVCAPEIRNDLAIEQAEFQSIVSGEEISVAVKFQKAFLQEWDVP IVLAGNEVPGWADAGGSIQRRLVVFEFKQPVKEGDMK---LSEKLYREMPNIIRRRT--- -----------------------------------RRTGTLRTCM--------------L TRTSGRCSRSTSSTPARQSRARRTLS-------------RASYHRSTLPWARTAWC---- -------LSRTSRAHSRTTPLPTLCT

Alignment for Row 8

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-
>lcl|q1_Acatu155371013 | ref | YP_001426547.1 | hypothetical protein ATCV1_Z066R [Acanthocystis turfacea Chlorella virus 1]
----MVTNTPKKNMKSSKEEEQAAELSIITGIKRLGV-DDCLERLENMCQSW---RLYET TATFESQIISMFGALDVNFDDDLIDAVSTDRGYFGLREVNDKIKKSELEAMTLFHRL-RE LNLLPTK-----NDDNETHHDSLKKITKILEMI---FYTKKVVLSSYQAKIAVHQLAAEE GVVDLNPDIDSVLGSWNLRFRMVGDDVSQFQELLLYLLDCAMENGYRKQDGFLYEPI-VI DGRNMHSYRQVYEIKEFVYSRLRKEISFEHWSKGTQNMKNISSA--VEYLT-NCHDTQLP VLHKSRGTYAFTNGVYIASE---DR------FHCF-ETSE-TPLSDSVV----------- ---------AC-KFFEMKFDNTQY-----------DDWFDIPTP-----HLDSVMNHQQW PKEVQMWLLCLIGRVLYRTNEIDSWQVCPFFVGLAGTGKSLLVLKVIKQFFETVDVGILS NNIERKFGISAFYDKMLVCAPEIRNDLAIEQAEFQSIVSGEEISVAVKFQKAFLQEWDVP IVLAGNEVPGWADAGGSIQRRLVVFEFKQPVKEGDMK---LSEKLYREMPNIIRRRT--- -----------------------------------RRTGTLRTCM--------------L TRTSGRCSRSTSSTPARQSRARRTLS-------------RASYHRSTLPWARTAWC---- -------LSRTSRAHSRTTPLPTLCT

Alignment for Row 9

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-
>lcl|q1_Acatu155371013 | ref | YP_001426547.1 | hypothetical protein ATCV1_Z066R [Acanthocystis turfacea Chlorella virus 1]
----MVTNTPKKNMKSSKEEEQAAELSIITGIKRLGV-DDCLERLENMCQSW---RLYET TATFESQIISMFGALDVNFDDDLIDAVSTDRGYFGLREVNDKIKKSELEAMTLFHRL-RE LNLLPTK-----NDDNETHHDSLKKITKILEMI---FYTKKVVLSSYQAKIAVHQLAAEE GVVDLNPDIDSVLGSWNLRFRMVGDDVSQFQELLLYLLDCAMENGYRKQDGFLYEPI-VI DGRNMHSYRQVYEIKEFVYSRLRKEISFEHWSKGTQNMKNISSA--VEYLT-NCHDTQLP VLHKSRGTYAFTNGVYIASE---DR------FHCF-ETSE-TPLSDSVV----------- ---------AC-KFFEMKFDNTQY-----------DDWFDIPTP-----HLDSVMNHQQW PKEVQMWLLCLIGRVLYRTNEIDSWQVCPFFVGLAGTGKSLLVLKVIKQFFETVDVGILS NNIERKFGISAFYDKMLVCAPEIRNDLAIEQAEFQSIVSGEEISVAVKFQKAFLQEWDVP IVLAGNEVPGWADAGGSIQRRLVVFEFKQPVKEGDMK---LSEKLYREMPNIIRRRT--- -----------------------------------RRTGTLRTCM--------------L TRTSGRCSRSTSSTPARQSRARRTLS-------------RASYHRSTLPWARTAWC---- -------LSRTSRAHSRTTPLPTLCT

Alignment for Row 10

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-
>lcl|q1_Acatu155371013 | ref | YP_001426547.1 | hypothetical protein ATCV1_Z066R [Acanthocystis turfacea Chlorella virus 1]
----MVTNTPKKNMKSSKEEEQAAELSIITGIKRLGV-DDCLERLENMCQSW---RLYET TATFESQIISMFGALDVNFDDDLIDAVSTDRGYFGLREVNDKIKKSELEAMTLFHRL-RE LNLLPTK-----NDDNETHHDSLKKITKILEMI---FYTKKVVLSSYQAKIAVHQLAAEE GVVDLNPDIDSVLGSWNLRFRMVGDDVSQFQELLLYLLDCAMENGYRKQDGFLYEPI-VI DGRNMHSYRQVYEIKEFVYSRLRKEISFEHWSKGTQNMKNISSA--VEYLT-NCHDTQLP VLHKSRGTYAFTNGVYIASE---DR------FHCF-ETSE-TPLSDSVV----------- ---------AC-KFFEMKFDNTQY-----------DDWFDIPTP-----HLDSVMNHQQW PKEVQMWLLCLIGRVLYRTNEIDSWQVCPFFVGLAGTGKSLLVLKVIKQFFETVDVGILS NNIERKFGISAFYDKMLVCAPEIRNDLAIEQAEFQSIVSGEEISVAVKFQKAFLQEWDVP IVLAGNEVPGWADAGGSIQRRLVVFEFKQPVKEGDMK---LSEKLYREMPNIIRRRT--- -----------------------------------RRTGTLRTCM--------------L TRTSGRCSRSTSSTPARQSRARRTLS-------------RASYHRSTLPWARTAWC---- -------LSRTSRAHSRTTPLPTLCT

Alignment for Row 11

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-
>lcl|q1_Acatu155371013 | ref | YP_001426547.1 | hypothetical protein ATCV1_Z066R [Acanthocystis turfacea Chlorella virus 1]
----MVTNTPKKNMKSSKEEEQAAELSIITGIKRLGV-DDCLERLENMCQSW---RLYET TATFESQIISMFGALDVNFDDDLIDAVSTDRGYFGLREVNDKIKKSELEAMTLFHRL-RE LNLLPTK-----NDDNETHHDSLKKITKILEMI---FYTKKVVLSSYQAKIAVHQLAAEE GVVDLNPDIDSVLGSWNLRFRMVGDDVSQFQELLLYLLDCAMENGYRKQDGFLYEPI-VI DGRNMHSYRQVYEIKEFVYSRLRKEISFEHWSKGTQNMKNISSA--VEYLT-NCHDTQLP VLHKSRGTYAFTNGVYIASE---DR------FHCF-ETSE-TPLSDSVV----------- ---------AC-KFFEMKFDNTQY-----------DDWFDIPTP-----HLDSVMNHQQW PKEVQMWLLCLIGRVLYRTNEIDSWQVCPFFVGLAGTGKSLLVLKVIKQFFETVDVGILS NNIERKFGISAFYDKMLVCAPEIRNDLAIEQAEFQSIVSGEEISVAVKFQKAFLQEWDVP IVLAGNEVPGWADAGGSIQRRLVVFEFKQPVKEGDMK---LSEKLYREMPNIIRRRT--- -----------------------------------RRTGTLRTCM--------------L TRTSGRCSRSTSSTPARQSRARRTLS-------------RASYHRSTLPWARTAWC---- -------LSRTSRAHSRTTPLPTLCT

Alignment for Row 12

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-
>lcl|q1_Acatu155371013 | ref | YP_001426547.1 | hypothetical protein ATCV1_Z066R [Acanthocystis turfacea Chlorella virus 1]
----MVTNTPKKNMKSSKEEEQAAELSIITGIKRLGV-DDCLERLENMCQSW---RLYET TATFESQIISMFGALDVNFDDDLIDAVSTDRGYFGLREVNDKIKKSELEAMTLFHRL-RE LNLLPTK-----NDDNETHHDSLKKITKILEMI---FYTKKVVLSSYQAKIAVHQLAAEE GVVDLNPDIDSVLGSWNLRFRMVGDDVSQFQELLLYLLDCAMENGYRKQDGFLYEPI-VI DGRNMHSYRQVYEIKEFVYSRLRKEISFEHWSKGTQNMKNISSA--VEYLT-NCHDTQLP VLHKSRGTYAFTNGVYIASE---DR------FHCF-ETSE-TPLSDSVV----------- ---------AC-KFFEMKFDNTQY-----------DDWFDIPTP-----HLDSVMNHQQW PKEVQMWLLCLIGRVLYRTNEIDSWQVCPFFVGLAGTGKSLLVLKVIKQFFETVDVGILS NNIERKFGISAFYDKMLVCAPEIRNDLAIEQAEFQSIVSGEEISVAVKFQKAFLQEWDVP IVLAGNEVPGWADAGGSIQRRLVVFEFKQPVKEGDMK---LSEKLYREMPNIIRRRT--- -----------------------------------RRTGTLRTCM--------------L TRTSGRCSRSTSSTPARQSRARRTLS-------------RASYHRSTLPWARTAWC---- -------LSRTSRAHSRTTPLPTLCT

Alignment for Row 13

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-
>lcl|q1_Acatu155371013 | ref | YP_001426547.1 | hypothetical protein ATCV1_Z066R [Acanthocystis turfacea Chlorella virus 1]
----MVTNTPKKNMKSSKEEEQAAELSIITGIKRLGV-DDCLERLENMCQSW---RLYET TATFESQIISMFGALDVNFDDDLIDAVSTDRGYFGLREVNDKIKKSELEAMTLFHRL-RE LNLLPTK-----NDDNETHHDSLKKITKILEMI---FYTKKVVLSSYQAKIAVHQLAAEE GVVDLNPDIDSVLGSWNLRFRMVGDDVSQFQELLLYLLDCAMENGYRKQDGFLYEPI-VI DGRNMHSYRQVYEIKEFVYSRLRKEISFEHWSKGTQNMKNISSA--VEYLT-NCHDTQLP VLHKSRGTYAFTNGVYIASE---DR------FHCF-ETSE-TPLSDSVV----------- ---------AC-KFFEMKFDNTQY-----------DDWFDIPTP-----HLDSVMNHQQW PKEVQMWLLCLIGRVLYRTNEIDSWQVCPFFVGLAGTGKSLLVLKVIKQFFETVDVGILS NNIERKFGISAFYDKMLVCAPEIRNDLAIEQAEFQSIVSGEEISVAVKFQKAFLQEWDVP IVLAGNEVPGWADAGGSIQRRLVVFEFKQPVKEGDMK---LSEKLYREMPNIIRRRT--- -----------------------------------RRTGTLRTCM--------------L TRTSGRCSRSTSSTPARQSRARRTLS-------------RASYHRSTLPWARTAWC---- -------LSRTSRAHSRTTPLPTLCT

Alignment for Row 14

>lcl|q1_ParNY157952927 | ref | YP_001497819.1 | hypothetical protein NY2A_B623L [Paramecium bursaria Chlorella virus NY2A]
--MGGLIDPKKSKVEEQDQKNKEREQTIATIIKKLNP-EQSIEKLNELANRW---KLYDE SATFETQTIHMFMALGVDFNDDLNESVKMDRGSFGMRQVDDKIRESEIEAISLYHRL-RE LNLFPDK-----MNNNVDKSMNLKKMTKILEMI---FYSKKVVLSAFQAKLAVYQLANED GVIELDQDLDTQLGSWALRFRFIEGDVSSFQELLLFLLDSAMEKKYRKVGDWLYEPI-II DGRDMHSWRAVSEIKDFVYSRLKKEISWEQWKNATLNMKNVGSA--VEYLT-NCHDYQLP FLHKSRGVYSFYNGVYIAPE---DR------FHCF-DTEK-EPLSDSIV----------- ---------AS-KFIENIFDNTHY-----------DDWFDIPTP-----HLDSIMIFQQW EEEVQRWLFALLGRMLYPVNQVDSWQVVPFFKGLAATGKSTIILKVIKNFFETVDVGILS NNIERKFGISAFHDKFCVLAPEIKNDLAIEQAEFQSMVSGEDVQVNVKHKKAFAEEWRVP MALAGNEVPGWADNGGSIQRRLIVFEFKKPVRHGDMK---LGEKLDKELPYILRKCNKAY LDLAGKYSDVNIWSV-------LPEYFINTREALARATNFIESFM---------ASSEVI LGENEICSLGDFKSALREHATTNVMH-TKQLTADVFAGPFEKYGIKFLGAQTLDYC---G QSVHTE-FIQGLSLKSSRPKDSNMF-
>lcl|q1_Acatu155371013 | ref | YP_001426547.1 | hypothetical protein ATCV1_Z066R [Acanthocystis turfacea Chlorella virus 1]
----MVTNTPKKNMKSSKEEEQAAELSIITGIKRLGV-DDCLERLENMCQSW---RLYET TATFESQIISMFGALDVNFDDDLIDAVSTDRGYFGLREVNDKIKKSELEAMTLFHRL-RE LNLLPTK-----NDDNETHHDSLKKITKILEMI---FYTKKVVLSSYQAKIAVHQLAAEE GVVDLNPDIDSVLGSWNLRFRMVGDDVSQFQELLLYLLDCAMENGYRKQDGFLYEPI-VI DGRNMHSYRQVYEIKEFVYSRLRKEISFEHWSKGTQNMKNISSA--VEYLT-NCHDTQLP VLHKSRGTYAFTNGVYIASE---DR------FHCF-ETSE-TPLSDSVV----------- ---------AC-KFFEMKFDNTQY-----------DDWFDIPTP-----HLDSVMNHQQW PKEVQMWLLCLIGRVLYRTNEIDSWQVCPFFVGLAGTGKSLLVLKVIKQFFETVDVGILS NNIERKFGISAFYDKMLVCAPEIRNDLAIEQAEFQSIVSGEEISVAVKFQKAFLQEWDVP IVLAGNEVPGWADAGGSIQRRLVVFEFKQPVKEGDMK---LSEKLYREMPNIIRRRT--- -----------------------------------RRTGTLRTCM--------------L TRTSGRCSRSTSSTPARQSRARRTLS-------------RASYHRSTLPWARTAWC---- -------LSRTSRAHSRTTPLPTLCT